DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and Lin28a

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001102739.1 Gene:Lin28a / 500562 RGDID:1566408 Length:209 Species:Rattus norvegicus


Alignment Length:190 Identity:75/190 - (39%)
Similarity:102/190 - (53%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENVQLENGLERRTTSQSSTSSANPANLASPTEECGCVR-LGKCKWFNVAKGWGFLTPN------ 58
            :.|.|...|..:  .::.:...| ||:.|...:|...:. .|.||||||..|:|||:..      
  Rat     4 VSNQQFAGGCAK--AAEKAPEEA-PADAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVA 65

  Fly    59 -DGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPR----I 118
             |...:||||||.:.|.|||||.|.|.|||..:::::|||:.||:...|..|.||..||:    .
  Rat    66 LDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQ 130

  Fly   119 NRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSI 178
            .||::..||||||...:| |.||.|.||||:||.|:...|:.|.||.|......|..|.:
  Rat   131 KRRSKGDRCYNCGGLDHH-AKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSSQGKPV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 32/66 (48%)
Lin28aNP_001102739.1 CSD 42..112 CDD:278729 34/69 (49%)
AIR1 <120..>183 CDD:227414 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345364
Domainoid 1 1.000 66 1.000 Domainoid score I9700
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4638
OMA 1 1.010 - - QHG45847
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm45883
orthoMCL 1 0.900 - - OOG6_105612
Panther 1 1.100 - - LDO PTHR46109
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.