DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and zcchc9

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001011465.1 Gene:zcchc9 / 496956 XenbaseID:XB-GENE-972766 Length:246 Species:Xenopus tropicalis


Alignment Length:233 Identity:50/233 - (21%)
Similarity:71/233 - (30%) Gaps:79/233 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASPTEECGCVRLGK-CKWFNVAKGWGFLTP-----NDGG-------------------QEVFVHQ 68
            |.|......||..| |    .|..||.|..     .:||                   ::|:|:|
 Frog     5 ARPGTSSAAVRNRKVC----AASPWGELQQQQRPHGEGGAGKRKAPVPQPPPNNKKKKKDVYVNQ 65

  Fly    69 SV-------IQMSGFRSLGEQEEVE----------------FECQRTSRGL----EATRVSSRHG 106
            .|       .::.|..|..:::..|                |.|::...|:    |..|......
 Frog    66 DVNGFGQYQAELGGVESPRKEQRREDRRLKRQTHKKDRMICFHCRKPGHGMADCAEVLRCQESGT 130

  Fly   107 GSC--QGSTYRPRINRRTR---------RMRCYNCGEFANHIASECALGP-----QPKRCHRCRG 155
            |.|  .|||.......|.:         ..:|:.|||. .|::..|...|     :...|..|..
 Frog   131 GICFRCGSTEHELTKCRAKVDPALGEFPFAKCFICGEM-GHLSRSCPDNPKGLYAEGGSCRICGS 194

  Fly   156 EDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEE 193
            .:|...|||      .|.||..|:....|.......||
 Frog   195 VEHFQRDCP------QHQNSAQITVKRWSKGMSADYEE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 19/111 (17%)
zcchc9NP_001011465.1 PTZ00368 <106..203 CDD:173561 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.