DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and YBX1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_004550.2 Gene:YBX1 / 4904 HGNCID:8014 Length:324 Species:Homo sapiens


Alignment Length:185 Identity:57/185 - (30%)
Similarity:77/185 - (41%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSQSSTSSANPANLASPTEECGCVR------LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQM 73
            |:.|...|..|..|.|.....|..:      ||..|||||..|:||:..||..::|||||:.|:.
Human    29 TTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKK 93

  Fly    74 SG----FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFA 134
            :.    .||:|:.|.|||:.....:|.||..|:...|...|||.|....|...|           
Human    94 NNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRR----------- 147

  Fly   135 NHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQE 189
                       .|:|    ||        |.:|..|::.||:|...|..|.:|.|
Human   148 -----------YPRR----RG--------PPRNYQQNYQNSESGEKNEGSESAPE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 27/63 (43%)
YBX1NP_004550.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 6/19 (32%)
Interaction with ss-DNA. /evidence=ECO:0000269|PubMed:11851341 15..71 14/41 (34%)
CSD 59..128 CDD:278729 29/68 (43%)
C5-methylcytosine binding. /evidence=ECO:0000269|PubMed:31358969, ECO:0007744|PDB:6A6L 65..70 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..324 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.