DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and csdc2a

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001002690.1 Gene:csdc2a / 436963 ZFINID:ZDB-GENE-040718-442 Length:153 Species:Danio rerio


Alignment Length:68 Identity:24/68 - (35%)
Similarity:35/68 - (51%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LERRTTSQSSTSSANPAN-----LASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQS 69
            |||:........|..|..     .||...:.|.|..|.||.|:.::|.||:.|:.||:::|||.|
Zfish    35 LERKPPQTGEPLSPLPTKRTRTYSASVRAKSGPVYKGICKNFSRSQGHGFIRPSHGGEDIFVHIS 99

  Fly    70 VIQ 72
            .|:
Zfish   100 DIE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 15/32 (47%)
csdc2aNP_001002690.1 CSP_CDS 69..134 CDD:239905 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.