DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and lin28ab

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_005159592.1 Gene:lin28ab / 394066 ZFINID:ZDB-GENE-040426-747 Length:207 Species:Danio rerio


Alignment Length:177 Identity:74/177 - (41%)
Similarity:99/177 - (55%) Gaps:15/177 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASPTEECGCVR-LGKCKWFNVAKGWGFLTPN-------DGGQEVFVHQSVIQMSGFRSLGEQEEV 85
            ||..|:.|... .|.||||||..|:|||:..       |...:||||||.:.|.|||||.|.|.|
Zfish    28 ASSEEDSGSFHGSGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAV 92

  Fly    86 EFECQRTSRGLEATRVSSRHGGSCQGSTYRPR--INRRTRRMRCYNCGEFANHIASECALGPQPK 148
            ||..:|:|:|||:.:|:...|..|.||..:|:  ..||::..||:|||. .||.|.||.|.||||
Zfish    93 EFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDRCFNCGG-PNHHAKECQLPPQPK 156

  Fly   149 RCHRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEEAT 195
            :||.|:...|:.|:||.|    :...|......|::|..:|:....|
Zfish   157 KCHFCQSISHMVANCPIK----AQQLSPGSQGKSTTSTGEEEDMSHT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 34/66 (52%)
lin28abXP_005159592.1 CSP_CDS 41..110 CDD:239905 35/68 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586408
Domainoid 1 1.000 70 1.000 Domainoid score I9487
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4481
OMA 1 1.010 - - QHG45847
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm25032
orthoMCL 1 0.900 - - OOG6_105612
Panther 1 1.100 - - LDO PTHR46109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4631
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.