DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and LIN28B

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_006715540.2 Gene:LIN28B / 389421 HGNCID:32207 Length:269 Species:Homo sapiens


Alignment Length:190 Identity:82/190 - (43%)
Similarity:108/190 - (56%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LERRTTSQSSTSSA----------NPANLASPTEECGCV--RLGKCKWFNVAKGWGFL------- 55
            |::|..|.:..|||          .|..|..|.||...|  ..|.||||||..|:||:       
Human     8 LQKRMRSFNQVSSAPGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREG 72

  Fly    56 TPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPR--- 117
            :|.|...:||||||.:.|.|||||.|.|.|||..:::|:|||:.||:...|..|.||..||:   
Human    73 SPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKT 137

  Fly   118 -INRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSK 176
             ..|:.:..||||||...:| |.||:|.||||:||.|:...|:.|:||||||.|..::|:
Human   138 LQKRKPKGDRCYNCGGLDHH-AKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 33/66 (50%)
LIN28BXP_006715540.2 CSP_CDS 50..120 CDD:239905 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151845
Domainoid 1 1.000 67 1.000 Domainoid score I9819
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47607
Inparanoid 1 1.050 138 1.000 Inparanoid score I4531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm41750
orthoMCL 1 0.900 - - OOG6_105612
Panther 1 1.100 - - O PTHR46109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4631
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.