DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and Lin28b

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_011241482.1 Gene:Lin28b / 380669 MGIID:3584032 Length:303 Species:Mus musculus


Alignment Length:224 Identity:78/224 - (34%)
Similarity:107/224 - (47%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTTSQSSTSSANPANLASPTEECGCVR--------LGKCKWFNVAKGWGFLT-------PNDGGQ 62
            |:.:|.|::....:....|.:..|...        .|.||||||..|:||::       |.|...
Mouse    26 RSFNQGSSAPGGASKGEEPEKLPGLAEDEPQVLHGTGHCKWFNVRMGFGFISMISREGNPLDIPV 90

  Fly    63 EVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPR---------- 117
            :||||||.:.|.|||||.|.|.|||..:::.:|||:.||:...|..|.||..||:          
Mouse    91 DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPK 155

  Fly   118 ----------------INRRTRRM--RCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCP 164
                            :.....||  ||||||...:| |.||:|.||||:||.|:...|:.|:||
Mouse   156 GDRWRRQDLLMDQMWTVREEESRMIPRCYNCGGLDHH-AKECSLPPQPKKCHYCQSIMHMVANCP 219

  Fly   165 HKNVTQ----SHSNSKSISNNSSSSAAQE 189
            ||...|    |....::.|...||:|.:|
Mouse   220 HKLAAQLPASSQGRQEAESQPCSSAAPRE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 32/66 (48%)
Lin28bXP_011241482.1 CSP_CDS 61..131 CDD:239905 34/69 (49%)
PTZ00368 <183..219 CDD:173561 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841969
Domainoid 1 1.000 66 1.000 Domainoid score I9890
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47607
Inparanoid 1 1.050 129 1.000 Inparanoid score I4631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm43801
orthoMCL 1 0.900 - - OOG6_105612
Panther 1 1.100 - - O PTHR46109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4631
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.