DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and cnbpa

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001231665.1 Gene:cnbpa / 326846 ZFINID:ZDB-GENE-030131-5045 Length:163 Species:Danio rerio


Alignment Length:137 Identity:37/137 - (27%)
Similarity:56/137 - (40%) Gaps:28/137 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TEEC-GCVRLGKCKWF----NVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQR 91
            |.|| ||.|.|  .|.    |..:|.|  .....|:::|.::          .|||..:..:|::
Zfish     5 TSECFGCGRSG--HWIKNCPNAGRGRG--RGRGRGKDLFCYR----------CGEQGHIARDCEQ 55

  Fly    92 TSRGLEATRVSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGE 156
            |    |....:....|........|   ::.|...|||||: |.|:|.:|....:.| |:.|.|.
Zfish    56 T----EDACYNCHRSGHISRDCKEP---KKEREQCCYNCGK-AGHVARDCDHANEQK-CYSCGGF 111

  Fly   157 DHLHADC 163
            .|:...|
Zfish   112 GHIQKLC 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 13/63 (21%)
cnbpaNP_001231665.1 PTZ00368 40..157 CDD:173561 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.