DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and Csdc2

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001164013.1 Gene:Csdc2 / 266600 RGDID:628780 Length:154 Species:Rattus norvegicus


Alignment Length:75 Identity:26/75 - (34%)
Similarity:40/75 - (53%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGF 76
            :||.:.|:|:.|:          .|.|..|.||.|:.::|.||:||.:|.:::|||.|.|:    
  Rat    53 KRTRTYSATARAS----------AGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIE---- 103

  Fly    77 RSLGEQEEVE 86
               ||...||
  Rat   104 ---GEYVPVE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 19/46 (41%)
Csdc2NP_001164013.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..62 3/8 (38%)
CSP_CDS 71..135 CDD:239905 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.