DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and byr3

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_593680.1 Gene:byr3 / 2542829 PomBaseID:SPAC13D6.02c Length:179 Species:Schizosaccharomyces pombe


Alignment Length:68 Identity:24/68 - (35%)
Similarity:28/68 - (41%) Gaps:19/68 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PRINRRTR-RMRCYNCGEFAN------------------HIASECALGPQPKRCHRCRGEDHLHA 161
            |.:.:.|| ..|||||||..:                  |.||||....|.|.|:.|....||..
pombe     7 PTVPQTTRPGPRCYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVR 71

  Fly   162 DCP 164
            |||
pombe    72 DCP 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905
byr3NP_593680.1 PTZ00368 19..174 CDD:173561 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.