powered by:
Protein Alignment lin-28 and byr3
DIOPT Version :9
Sequence 1: | NP_647983.1 |
Gene: | lin-28 / 38639 |
FlyBaseID: | FBgn0035626 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_593680.1 |
Gene: | byr3 / 2542829 |
PomBaseID: | SPAC13D6.02c |
Length: | 179 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 68 |
Identity: | 24/68 - (35%) |
Similarity: | 28/68 - (41%) |
Gaps: | 19/68 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 PRINRRTR-RMRCYNCGEFAN------------------HIASECALGPQPKRCHRCRGEDHLHA 161
|.:.:.|| ..|||||||..: |.||||....|.|.|:.|....||..
pombe 7 PTVPQTTRPGPRCYNCGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVR 71
Fly 162 DCP 164
|||
pombe 72 DCP 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lin-28 | NP_647983.1 |
CSP_CDS |
41..101 |
CDD:239905 |
|
byr3 | NP_593680.1 |
PTZ00368 |
19..174 |
CDD:173561 |
20/56 (36%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.