DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and Ybx1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_006502996.1 Gene:Ybx1 / 22608 MGIID:99146 Length:326 Species:Mus musculus


Alignment Length:182 Identity:56/182 - (30%)
Similarity:75/182 - (41%) Gaps:44/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSTSSANPANLASPTEECGCVR------LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG- 75
            |...|..|..|.|.....|..:      ||..|||||..|:||:..||..::|||||:.|:.:. 
Mouse    30 SGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNP 94

  Fly    76 ---FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHI 137
               .||:|:.|.|||:.....:|.||..|:...|...|||.|....|...|              
Mouse    95 RKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRR-------------- 145

  Fly   138 ASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQE 189
                    .|:|    ||        |.:|..|::.||:|...|..|.:|.|
Mouse   146 --------YPRR----RG--------PPRNYQQNYQNSESGEKNEGSESAPE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 27/63 (43%)
Ybx1XP_006502996.1 CSD 57..126 CDD:278729 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.