DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and cey-4

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_499393.1 Gene:cey-4 / 176516 WormBaseID:WBGene00000475 Length:294 Species:Caenorhabditis elegans


Alignment Length:93 Identity:30/93 - (32%)
Similarity:46/93 - (49%) Gaps:10/93 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFLT---PNDGGQEVFVHQSVIQMSG-----FRSLGEQEEVEFECQRTSRGLE 97
            |..|||:|...:||:.   |.|..::.||||:.|..|.     .|:|.:.|.|.|:.....:|.|
 Worm    91 GHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPE 155

  Fly    98 ATRVSSRHGGSCQGSTYRPRI--NRRTR 123
            |..|:...|.:.:||.:...:  :.|||
 Worm   156 AANVTGPDGENVRGSRFARTLLTHWRTR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 23/67 (34%)
cey-4NP_499393.1 CSD 89..162 CDD:278729 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.