DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and cey-1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_496366.1 Gene:cey-1 / 174690 WormBaseID:WBGene00000472 Length:208 Species:Caenorhabditis elegans


Alignment Length:78 Identity:35/78 - (44%)
Similarity:46/78 - (58%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG----FRSLGEQEEVEFECQRTSRGLEATRV 101
            |..|||||..|:||:...|..:::||||:.|..:.    .||||:.|||.|:....|:||||..|
 Worm    23 GTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASV 87

  Fly   102 SSRHGGSCQGSTY 114
            :...||..|||.|
 Worm    88 TGPDGGPVQGSKY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 28/63 (44%)
cey-1NP_496366.1 CSD 21..90 CDD:278729 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.