DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and cey-3

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001367859.1 Gene:cey-3 / 172211 WormBaseID:WBGene00000474 Length:265 Species:Caenorhabditis elegans


Alignment Length:172 Identity:48/172 - (27%)
Similarity:79/172 - (45%) Gaps:29/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG-----FRSLGEQEEVEFECQRTSRGLEATR 100
            ||.||::|.:.:||::.:||.::|||||:.|..|.     .|:|.::|||.|:......|.||..
 Worm    66 GKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAAN 130

  Fly   101 VSSRHGGSCQGSTYRPRINRRTRRMR--------CYNCGEFANHIASECALGPQPKRCHRCRGED 157
            |:...|.:..||.||.::..|.|:.|        .::..| ...:....|:..:.|:..:.|   
 Worm   131 VTGPAGVNVSGSKYRHQLLSRFRKNRKPKIVVGEDFDSKE-TEKLVEAPAVAMEKKKQRKQR--- 191

  Fly   158 HLHADCPHKNVTQSHSNSKSISNNSSSSAAQE----KSEEAT 195
                    ||..:...:.|...:.:.|||..|    .||.|:
 Worm   192 --------KNKNRKQKDQKGAGDAADSSATTESLGTSSETAS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 25/64 (39%)
cey-3NP_001367859.1 CSD 64..134 CDD:278729 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.