DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and lin28b

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_021324027.1 Gene:lin28b / 103752590 ZFINID:ZDB-GENE-140811-1 Length:256 Species:Danio rerio


Alignment Length:189 Identity:80/189 - (42%)
Similarity:106/189 - (56%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLT-------PNDGGQEVFVHQSVIQMSG 75
            |.|:...|.:|:..         |.||||||..|:||::       |.|...:||||||.:.|.|
Zfish    55 SDTARTPPQSLSGS---------GYCKWFNVRMGFGFISMTSSEGKPVDPPLDVFVHQSKLVMEG 110

  Fly    76 FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPR-----INRRTRRMRCYNCGEFAN 135
            ||||.|.|:|||..:|:|:|||:.||:...||.|.||..||:     :.|:.:..||||||...:
Zfish   111 FRSLREGEQVEFTFKRSSKGLESLRVTGPGGGPCSGSERRPKAKAPPLKRKPKGDRCYNCGGLDH 175

  Fly   136 HIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEEA 194
            | |.||.|.||||:||.|:...|:.|.||||.   :.|.|.|......|::||...||:
Zfish   176 H-AKECGLPPQPKKCHYCQSVTHMVAQCPHKG---APSPSASQDPQRPSTSAQSPEEES 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 34/66 (52%)
lin28bXP_021324027.1 CSP_CDS 69..137 CDD:239905 35/67 (52%)
AIR1 <157..209 CDD:331526 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586409
Domainoid 1 1.000 70 1.000 Domainoid score I9487
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4481
OMA 1 1.010 - - QHG45847
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm25032
orthoMCL 1 0.900 - - OOG6_105612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.670

Return to query results.
Submit another query.