DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and ybx2

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001123667.1 Gene:ybx2 / 100170415 XenbaseID:XB-GENE-5798907 Length:337 Species:Xenopus tropicalis


Alignment Length:154 Identity:48/154 - (31%)
Similarity:72/154 - (46%) Gaps:22/154 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG- 75
            ::.|..::.:..|...||:..:       |..|||||..|:||:..||..::|||||:.|:.:. 
 Frog    22 QKPTISAARNQPNKKVLATQVQ-------GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNP 79

  Fly    76 ---FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRP---RINRRTRRMRCYNCGEFA 134
               .||:|:.|.|||:.....:|.||..|:...|...:||.:.|   |..||..|.|....||..
 Frog    80 RKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRRFYRPRADTAGESG 144

  Fly   135 NHIASECALGPQPKRCHRC-RGED 157
            ..       |..|::.... |||:
 Frog   145 GE-------GVSPEQMSEGERGEE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 27/63 (43%)
ybx2NP_001123667.1 CSD 42..111 CDD:278729 28/75 (37%)
PRK07764 <193..336 CDD:236090
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.