DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and MIG3

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_010945.1 Gene:MIG3 / 856750 SGDID:S000000830 Length:394 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:67/267 - (25%)
Similarity:103/267 - (38%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   915 ERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDI--CKKRFSSTSNLKTHLRLHS-------- 969
            :|||:|.:|::.|.:|.|.::|...|||||||:|.:  |.|.||.:..||.|||.|:        
Yeast    14 QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRRI 78

  Fly   970 ---GQKPYACD---LCPQKFTQFVHLKLHKRLHTNDRPY---VCQGCDKKYISASGLRTHWKTTS 1025
               |.:....:   ..|..|.:...:.|.....:...|.   |.|.||...|..:|         
Yeast    79 KSKGSRKTVVNTATAAPTTFNENTGVSLTGIGQSKVPPILISVAQNCDDVNIRNTG--------- 134

  Fly  1026 CKPNNLEEELAMAAAATSECLDKD-HPEPDSREAYEQLTQ--HMHPAVHPGLRHLSSGGQSPPRL 1087
             ..|.:.|..|.|.......:..| ||.|.|... ..:|.  .::|:..| .::|.||....|..
Yeast   135 -NNNGIVETQAPAILVPVINIPNDPHPIPSSLST-TSITSIASVYPSTSP-FQYLKSGFPEDPAS 196

  Fly  1088 IPL----GNHMAPQQQSHQQ---QQQQHQQQGVPPPHLLMTQHSVGPAPMLLTTASQLPPPPPHH 1145
            .|.    |:.:|..:.|...   .:.:.....:..|..|.:..:...|.:|..|:         |
Yeast   197 TPYVHSSGSSLALGELSSNSSIFSKSRRNLAAMSGPDSLSSSKNQSSASLLSQTS---------H 252

  Fly  1146 QQNSPSR 1152
            ...|.||
Yeast   253 PSKSFSR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368
zf-H2C2_2 904..929 CDD:290200 6/13 (46%)
C2H2 Zn finger 920..940 CDD:275368 6/19 (32%)
zf-H2C2_2 932..957 CDD:290200 13/26 (50%)
C2H2 Zn finger 948..968 CDD:275368 10/21 (48%)
zf-H2C2_2 960..985 CDD:290200 9/38 (24%)
C2H2 Zn finger 976..996 CDD:275368 3/22 (14%)
C2H2 Zn finger 1004..1023 CDD:275368 5/18 (28%)
MIG3NP_010945.1 COG5048 1..394 CDD:227381 67/267 (25%)
C2H2 Zn finger 19..39 CDD:275368 6/19 (32%)
C2H2 Zn finger 47..69 CDD:275368 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4354
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.