DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and IDD14

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_176980.1 Gene:IDD14 / 843141 AraportID:AT1G68130 Length:419 Species:Arabidopsis thaliana


Alignment Length:411 Identity:78/411 - (18%)
Similarity:130/411 - (31%) Gaps:152/411 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 PPSS----LSPDGNSCP--------RSGSP--------LSPNSLASRGYRSLPYPLKKKDGKMHY 890
            ||||    |.||||...        .:|:|        |||.:|....               .|
plant    21 PPSSSSSDLLPDGNGTAVTQKRKRRPAGTPDPEAEVVSLSPRTLLESD---------------RY 70

  Fly   891 ECNVCCKTFGQLSNLKVHLRTHS--------------GERPFKC--------NVCTKSFTQLAHL 933
            .|.:|.:.|.:..||::|.|.|.              .:|.:.|        |.| .:...|..:
plant    71 VCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETNEEVRKRVYVCPEPTCLHHNPC-HALGDLVGI 134

  Fly   934 QKH-HLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHT 997
            :|| ...|:..|...|:.|.|.::..|:.|.||:. .|.:.::|| |.:.|::......|:    
plant   135 KKHFRRKHSNHKQWICERCSKGYAVQSDYKAHLKT-CGTRGHSCD-CGRVFSRVESFIEHQ---- 193

  Fly   998 NDRPYVCQGCDKKYISASGLRTH---------WKTTSCKPNNLEEELAMAAAATSECLDKDHPEP 1053
                   ..|..:....|..|.|         .:|.|...||...:|::........|.:....|
plant   194 -------DTCTVRRSQPSNHRLHEQQQHTTNATQTASTAENNENGDLSIGPILPGHPLQRRQSPP 251

  Fly  1054 DSREAYEQLTQHMHPAVHPGLRHLSSGGQSPPRLIPLGN-------------------------- 1092
            ..    :|.:..::|.|        :.|....:|:|..|                          
plant   252 SE----QQPSTLLYPFV--------TNGSIELQLLPSRNCADETSLSLSIGTMDQKTMSEVEKKS 304

  Fly  1093 ---------------------HMAPQQQSHQQQQQQHQQQGVPPPHLLMTQHS--VGPAPMLLT- 1133
                                 .:|..:.:..::.:||.:..:...||...:.|  :....|.:| 
plant   305 YEKGETSLEREEARRETKRQIEIAELEFAEAKRIRQHARAELHKAHLFREEASRRISATMMQITC 369

  Fly  1134 ---------TASQLPPPPPHH 1145
                     .|:.:||||..|
plant   370 HNCKQHFQAPAALVPPPPQTH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/19 (37%)
zf-H2C2_2 904..929 CDD:290200 9/46 (20%)
C2H2 Zn finger 920..940 CDD:275368 6/28 (21%)
zf-H2C2_2 932..957 CDD:290200 7/25 (28%)
C2H2 Zn finger 948..968 CDD:275368 7/19 (37%)
zf-H2C2_2 960..985 CDD:290200 8/24 (33%)
C2H2 Zn finger 976..996 CDD:275368 5/19 (26%)
C2H2 Zn finger 1004..1023 CDD:275368 4/27 (15%)
IDD14NP_176980.1 C2H2 Zn finger 72..92 CDD:275368 7/19 (37%)
C2H2 Zn finger 150..169 CDD:275368 7/18 (39%)
C2H2 Zn finger 177..195 CDD:275368 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.