DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and SGR5

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_001077868.1 Gene:SGR5 / 814725 AraportID:AT2G01940 Length:446 Species:Arabidopsis thaliana


Alignment Length:391 Identity:85/391 - (21%)
Similarity:138/391 - (35%) Gaps:116/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   794 SSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPL-TPLQRLSPLRISPPSSLSPDGNSC 857
            ||..||  .|::.:|. :.||     ||||....   :|. ||......:.:||.:.|..|...|
plant    22 SSSDPF--LSSSENGV-TTTN-----TSTQKRKR---RPAGTPDPDAEVVSLSPRTLLESDRYIC 75

  Fly   858 P--RSGSPLSPNSLASRGYRSLPYPLKKKDG-----KMHYEC--NVC-----CKTFGQLSNLKVH 908
            .  ..|.....|....|....:|:.|.|:|.     |..|.|  ..|     |...|.|..:|.|
plant    76 EICNQGFQRDQNLQMHRRRHKVPWKLLKRDNNIEVKKRVYVCPEPTCLHHNPCHALGDLVGIKKH 140

  Fly   909 L-RTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQK 972
            . |.||..:.:.|..|:|.:...:. .|.||...|.:.|.|| |  .|.|:..:::.:. |.   
plant   141 FRRKHSNHKQWVCERCSKGYAVQSD-YKAHLKTCGTRGHSCD-C--GFFSSFRVESFIE-HQ--- 197

  Fly   973 PYACDLCPQKFTQFVHLKLHKRLHTN-DRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELA 1036
                |.|..           :|:|.. .||      .:..::.....:...:|...|:: |....
plant   198 ----DNCSA-----------RRVHREPPRP------PQTAVTVPACSSRTASTVSTPSS-ETNYG 240

  Fly  1037 MAAAATSECLDKDHPEP-DSREAYEQLTQHMHPAVHPGLRHLSSGGQSPPRLIPLGNHMAPQQQS 1100
            ...|.|:       |:| :.|..:::::..:       |.:.|:......:|:||.::..|.|::
plant   241 GTVAVTT-------PQPLEGRPIHQRISSSI-------LTNSSNNLNLELQLLPLSSNQNPNQEN 291

  Fly  1101 HQQQQQQHQQQGVPPPHLLMTQHSVGPAPMLLTTASQLPPPPPHHQQN----------SPSRLLQ 1155
            .||:.::       |.|                          ||..|          :||...|
plant   292 QQQKVKE-------PSH--------------------------HHNHNHDTTNLNLSIAPSSSYQ 323

  Fly  1156 H 1156
            |
plant   324 H 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 8/27 (30%)
zf-H2C2_2 904..929 CDD:290200 8/25 (32%)
C2H2 Zn finger 920..940 CDD:275368 6/19 (32%)
zf-H2C2_2 932..957 CDD:290200 9/24 (38%)
C2H2 Zn finger 948..968 CDD:275368 5/19 (26%)
zf-H2C2_2 960..985 CDD:290200 3/24 (13%)
C2H2 Zn finger 976..996 CDD:275368 3/19 (16%)
C2H2 Zn finger 1004..1023 CDD:275368 0/18 (0%)
SGR5NP_001077868.1 C2H2 Zn finger 75..95 CDD:275368 4/19 (21%)
C2H2 Zn finger 117..145 CDD:275368 8/27 (30%)
C2H2 Zn finger 153..172 CDD:275368 6/19 (32%)
ATP-synt_B <332..422 CDD:304375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.