DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Blimp-1 and Prdm12

DIOPT Version :9

Sequence 1:	NP_001261442.1	Gene:	Blimp-1 / 38638	FlyBaseID:	FBgn0035625	Length:	1216	Species:	Drosophila melanogaster
Sequence 2:	XP_001067974.2	Gene:	Prdm12 / 688699	RGDID:	1586401	Length:	365	Species:	Rattus norvegicus

Alignment Length:	130	Identity:	45/130 - (34%)
Similarity:	66/130 - (50%)	Gaps:	21/130 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   935 KHHLVHTGEKP------HQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHK 993
            ||...|..:..      .:|.||.:.|:|.|||::|:|:|:..||:.|..|.::|:|...|:.|.
  Rat   226 KHEDFHPADSATGTAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHV 290

  Fly   994 RLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEE---------------LAMAAAATS 1043
            ||||.:|||.||.|...|...:|||.|.|:...:|.:...:               ||.||||.:
  Rat   291 RLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAA 355

Fly 1044 1043
Rat 356 355

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Blimp-1	NP_001261442.1	SET	133..260	CDD:214614
		C2H2 Zn finger	892..912	CDD:275368
		zf-H2C2_2	904..929	CDD:290200
		C2H2 Zn finger	920..940	CDD:275368	2/4 (50%)
		zf-H2C2_2	932..957	CDD:290200	7/27 (26%)
		C2H2 Zn finger	948..968	CDD:275368	10/19 (53%)
		zf-H2C2_2	960..985	CDD:290200	10/24 (42%)
		C2H2 Zn finger	976..996	CDD:275368	7/19 (37%)
		C2H2 Zn finger	1004..1023	CDD:275368	8/18 (44%)
Prdm12	XP_001067974.2	PR-SET_PRDM12	84..213	CDD:380973
		zf-C2H2	244..265	CDD:395048	10/20 (50%)
		C2H2 Zn finger	245..265	CDD:275368	10/19 (53%)
		zf-H2C2_2	257..282	CDD:404364	10/24 (42%)
		C2H2 Zn finger	273..293	CDD:275368	7/19 (37%)
		zf-H2C2_2	286..310	CDD:404364	13/23 (57%)
		C2H2 Zn finger	301..319	CDD:275368	8/17 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2461
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810