DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Blimp-1 and prdm12b

DIOPT Version :9

Sequence 1:	NP_001261442.1	Gene:	Blimp-1 / 38638	FlyBaseID:	FBgn0035625	Length:	1216	Species:	Drosophila melanogaster
Sequence 2:	NP_001007458.1	Gene:	prdm12b / 492816	ZFINID:	ZDB-GENE-041114-172	Length:	366	Species:	Danio rerio

Alignment Length:	127	Identity:	47/127 - (37%)
Similarity:	66/127 - (51%)	Gaps:	17/127 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   947 QCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKY 1011
            :|.||.:.|:|.|||::|:|:|:..||:.|..|.::|:|...|:.|.||||.:|||.|..|...|
Zfish   248 RCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCHVCQSAY 312

  Fly  1012 ISASGLRTHWKTTSCKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPA--VH 1071
            ...:|||.|.|:...:|.|....:.:.|          |..|.     .||.|..|||  ||
Zfish   313 SQLAGLRAHQKSARHRPANTGAVVGLQA----------HSPPP-----PQLAQVPHPASLVH 359

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Blimp-1	NP_001261442.1	SET	133..260	CDD:214614
		C2H2 Zn finger	892..912	CDD:275368
		zf-H2C2_2	904..929	CDD:290200
		C2H2 Zn finger	920..940	CDD:275368
		zf-H2C2_2	932..957	CDD:290200	4/9 (44%)
		C2H2 Zn finger	948..968	CDD:275368	10/19 (53%)
		zf-H2C2_2	960..985	CDD:290200	10/24 (42%)
		C2H2 Zn finger	976..996	CDD:275368	7/19 (37%)
		C2H2 Zn finger	1004..1023	CDD:275368	7/18 (39%)
prdm12b	NP_001007458.1	SET	98..202	CDD:279228
		COG5048	248..>298	CDD:227381	21/49 (43%)
		zf-C2H2	248..269	CDD:278523	10/20 (50%)
		C2H2 Zn finger	249..269	CDD:275368	10/19 (53%)
		zf-H2C2_2	261..286	CDD:290200	10/24 (42%)
		C2H2 Zn finger	277..297	CDD:275368	7/19 (37%)
		zf-H2C2_2	290..314	CDD:290200	12/23 (52%)
		C2H2 Zn finger	305..323	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2461
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.810