DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and MTF-1

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster


Alignment Length:686 Identity:144/686 - (20%)
Similarity:238/686 - (34%) Gaps:194/686 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 NACRQANAATPPPTSPTEMAYSYKKSQRYGNAVSP------------DSSSNLGQNPEQLSSSAV 720
            |:.|.:.:.:||.||....:.|....:.....:.|            |:.|..|....:.:|   
  Fly    40 NSSRNSLSGSPPVTSNCSSSGSLDFDRPLAQLLEPKLEADGLGIIHGDNYSIYGSQTAESTS--- 101

  Fly   721 VVGEQEMTR--ATMIKGECS-------------PPPPSHHHHNVIFSPSRHAAYLGAGEAGGHSP 770
              |||::..  .|:..|:..             ....:|.|..|:.|.:...|:..|.:.   :|
  Fly   102 --GEQQVLNLGLTLDTGDAQATYGDLFGAQDQLTASQTHGHSQVVVSAAADNAFSLADQL---TP 161

  Fly   771 SPGYPGYPHYGAAATSTFHSPPH---SSHSPFDRQSNASSGAGSATNLH--LLQTSTQMLNHPLM 830
            .|        ......|:|....   ||||.....::.|.......||.  ......|..|..|:
  Fly   162 LP--------ITVIPITYHHTTENLSSSHSEVPLIASLSDITAQVFNLDDICFTLEYQFENQRLV 218

  Fly   831 QPLTPLQRLSPLRISPPSSLSP---------DGNSCPRSGSPLSP-------------------- 866
            |...|......:..||..:.:|         .|||..|..:..||                    
  Fly   219 QVQPPTVVSLSMVSSPNEAANPPINCDNDQGTGNSISRDSTSNSPAYFTIETSYVDEYDPNEPDE 283

  Fly   867 ----------------------------NSLASRGYRSLPYPLKKKDGKMHYECNV--CCKTFGQ 901
                                        :.|.:..|.|....|.:      |.||.  |.:::..
  Fly   284 DEQLAHCIQPGVLHQDVDEEEVERQDENDQLMALAYESSDEALSR------YRCNYENCYRSYST 342

  Fly   902 LSNLKVHLRTHSGERPFKC--NVCTKSFTQLAHLQKHHLVHTGEKPHQCDI-------------- 950
            :.||:.||:||:|:..|||  :.|.|:|.....|:.|..|||..||::|::              
  Fly   343 IGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLH 407

  Fly   951 ---------------CKKRFSSTSNLKTHLRLHSGQKPYAC--DLCPQKFTQFVHLKLHKRLHTN 998
                           |:|.|::.|:||.|:|.|:.::||.|  |.|.:.||...|||.|:|.||.
  Fly   408 AHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTG 472

  Fly   999 DRPYVCQ--GCDKKYISASGLRTHWKTTSCKPNNLEEELAMAAAATSECLDKDHPEPDSRE-AYE 1060
            ::||.||  .|.|.:.::..|::|.||...:..|...:........::|.|::..:|...| ..|
  Fly   473 EKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQLQNKGRKKRPLKTQQTKCSDQEQKDPQQEEQEEE 537

  Fly  1061 QLTQHMHP---AVHPGLR--------------------HLSS-----GGQSPPRLIPLGNHMAPQ 1097
            :..:...|   .::||..                    |||:     |.:  |.::|        
  Fly   538 EFIKEDQPEMTLLNPGSHCSETTSTDSGVVLQTLTPQDHLSNVFILQGNE--PLILP-------- 592

  Fly  1098 QQSHQQQQQQHQQQGVPPPHL---LMTQHSVGPAPMLLTTASQLPPPPPHHQQNSPSRLLQHGHA 1159
            :.|...|.....::.:|.|.:   ::....:.|...|......||...|......|:    .|:|
  Fly   593 ETSQAYQLSYAAEEEIPSPWIDAGVLVSKPIIPMAPLTDACVALPTEMPSFVNLKPT----FGNA 653

  Fly  1160 HPLQMQQQQQQQQQHSPKGLKSLPESGVYLHGQHVQ 1195
            ....|...|.:.....|....|||...:.|:..:::
  Fly   654 VSGNMGDPQPETMDVDPTVETSLPTPTLELNQPNIE 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/21 (33%)
zf-H2C2_2 904..929 CDD:290200 13/26 (50%)
C2H2 Zn finger 920..940 CDD:275368 6/21 (29%)
zf-H2C2_2 932..957 CDD:290200 11/53 (21%)
C2H2 Zn finger 948..968 CDD:275368 9/48 (19%)
zf-H2C2_2 960..985 CDD:290200 11/26 (42%)
C2H2 Zn finger 976..996 CDD:275368 10/21 (48%)
C2H2 Zn finger 1004..1023 CDD:275368 6/20 (30%)
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 46/141 (33%)
C2H2 Zn finger 331..353 CDD:275368 7/21 (33%)
zf-H2C2_2 345..372 CDD:290200 13/26 (50%)
C2H2 Zn finger 361..383 CDD:275368 6/21 (29%)
zf-H2C2_2 375..402 CDD:290200 8/26 (31%)
C2H2 Zn finger 391..413 CDD:275368 1/21 (5%)
zf-C2H2 418..440 CDD:278523 8/21 (38%)
C2H2 Zn finger 420..440 CDD:275368 8/19 (42%)
zf-H2C2_2 432..458 CDD:290200 10/25 (40%)
COG5048 442..>519 CDD:227381 25/76 (33%)
C2H2 Zn finger 448..470 CDD:275368 10/21 (48%)
zf-H2C2_2 462..489 CDD:290200 13/26 (50%)
C2H2 Zn finger 478..500 CDD:275368 7/21 (33%)
DUF3682 862..>931 CDD:289231
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.