DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and sna

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:496 Identity:119/496 - (23%)
Similarity:177/496 - (35%) Gaps:155/496 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 KTC-VKQEPSLKEVDQEMSLPQEE-----EEDQVMHPEPDSICPSTTTHLGDEHMLMMERERERE 589
            |:| :|:.|.   |..|..|||.|     ::.|....:|..              |.::|.|:.|
  Fly     6 KSCPLKKRPI---VFVEERLPQTEALALTKDSQFAQDQPQD--------------LSLKRGRDEE 53

  Fly   590 RERIQEREPSNQQPASSTVIVL----EHNSGGQARTIVPLSKPYYEPD-PPGERYMRFGQPSSSI 649
            .:..|:.||....     |:.|    |.||...:.:.: ||.|....| .|.|.:|| |..:.:.
  Fly    54 TQDYQQPEPKRDY-----VLNLSKTPERNSSSSSNSCL-LSPPVEAQDYLPTEIHMR-GLTAGTT 111

  Fly   650 LETIL--TSQHRLEAAAAAANACRQAN----------AATPPPTS---PTEMAYSYKKSQRYGNA 699
            ..|..  |:.:..::|...|..|...:          ||.|.|.|   ..:..|||   |:....
  Fly   112 GYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAAFPSPASSMASPQSVYSY---QQMTPP 173

  Fly   700 VSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAAYLGAGE 764
            .||.|....|..||.||                ::.:.  |.|:..|   :|..::     .:..
  Fly   174 SSPGSDLETGSEPEDLS----------------VRNDI--PLPALFH---LFDEAK-----SSSS 212

  Fly   765 AGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLH--------LLQTS 821
            ....|.|.||                    |::|....|:||..|..|.|..        :..||
  Fly   213 GASVSSSSGY--------------------SYTPAMSASSASVAANHAKNYRFKCDECQKMYSTS 257

  Fly   822 TQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDG 886
            ..:..|....                         ||.:..                    .::.
  Fly   258 MGLSKHRQFH-------------------------CPAAEC--------------------NQEK 277

  Fly   887 KMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDIC 951
            |.| .|..|.|.:..:..||:|:|||:  .|.||.:|.|:|::...||.|...||||||.||..|
  Fly   278 KTH-SCEECGKLYTTIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDC 339

  Fly   952 KKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLH 992
            .:.|:..|||:.|.:.|...|.|||.:|.:.|::...|..|
  Fly   340 PRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/19 (37%)
zf-H2C2_2 904..929 CDD:290200 12/24 (50%)
C2H2 Zn finger 920..940 CDD:275368 7/19 (37%)
zf-H2C2_2 932..957 CDD:290200 13/24 (54%)
C2H2 Zn finger 948..968 CDD:275368 7/19 (37%)
zf-H2C2_2 960..985 CDD:290200 10/24 (42%)
C2H2 Zn finger 976..996 CDD:275368 5/17 (29%)
C2H2 Zn finger 1004..1023 CDD:275368
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..344 CDD:290200 12/22 (55%)
zf-C2H2 334..356 CDD:278523 8/21 (38%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 10/24 (42%)
C2H2 Zn finger 364..380 CDD:275368 4/15 (27%)
C2H2 Zn finger 247..267 CDD:275368 3/19 (16%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-C2H2 306..328 CDD:278523 8/21 (38%)
COG5048 307..>356 CDD:227381 22/48 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.