DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and esg

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:539 Identity:134/539 - (24%)
Similarity:198/539 - (36%) Gaps:161/539 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 DKNEYRKFKV-KMPLKYEF---KNKTCVKQEPSLKEVDQEMSLPQEEEEDQVMHP----EPDSIC 567
            :|| |.|..: |.|:.|:|   :|.:....||....| ::|.:.:|...:::::.    |.:.: 
  Fly    10 EKN-YSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCV-KKMEILEENPSEELINVSDCCEDEGV- 71

  Fly   568 PSTTTHLGDEHMLMMERERERERERIQ---EREPSNQQPASSTVIVLEHNSGGQARTIVPLSKPY 629
              ...|..|||:       |.|.|.:.   :.:|:..|.|:.                       
  Fly    72 --DVDHTDDEHI-------EEEDEDVDVDVDSDPNQTQAAAL----------------------- 104

  Fly   630 YEPDPPGERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSP----------T 684
                                            |||||..|...|:...|.||.|          .
  Fly   105 --------------------------------AAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSP 137

  Fly   685 EMAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHH--- 746
            ..|..|:...:.|:.:.|.....:.  |...|.|.               |..||||  ||:   
  Fly   138 YTAEFYRTINQQGHQILPLRGDLIA--PSSPSDSL---------------GSLSPPP--HHYLHG 183

  Fly   747 ----------HNVIFSP--SRHAAYLGAGEAGGHSPSPGYPGYPHYGAAATSTFH-----SPPHS 794
                      ..:|..|  .|...:|         |.|..||||..| ..|.|.|     ||.:|
  Fly   184 RASSVSPPMRSEIIHRPIGVRQHRFL---------PYPQMPGYPSLG-GYTHTHHHHAPISPAYS 238

  Fly   795 SHSPFDRQSNASSGAGSAT----------NLHL-LQTSTQMLNHPLMQPLTPLQRLSPLRISPPS 848
            .:|.:..:|.....:.|::          ||:| |.||     .|..|.......:|| ...|.:
  Fly   239 ENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTS-----QPGEQAAAKTGDMSP-ETMPNA 297

  Fly   849 SLSPDGNSCPRSGSPLSPNSLAS----RGYRSLPYPLKK-KDGKMHYECNVCCKTFGQLSNLKVH 908
            |...|.|..||...|....|.::    ..::....|..: ...|..:.|..|.||:..|..||:|
  Fly   298 SAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMH 362

  Fly   909 LRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKP 973
            :|||:  .|.|||:|.|:|::...||.|...||||||..|..|.:.|:..|||:.||:.||..|.
  Fly   363 IRTHT--LPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKK 425

  Fly   974 YACDLCPQKFTQFVHLKLH 992
            |:|..|.:.|::...|..|
  Fly   426 YSCTSCSKTFSRMSLLTKH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 9/19 (47%)
zf-H2C2_2 904..929 CDD:290200 13/24 (54%)
C2H2 Zn finger 920..940 CDD:275368 8/19 (42%)
zf-H2C2_2 932..957 CDD:290200 12/24 (50%)
C2H2 Zn finger 948..968 CDD:275368 8/19 (42%)
zf-H2C2_2 960..985 CDD:290200 11/24 (46%)
C2H2 Zn finger 976..996 CDD:275368 5/17 (29%)
C2H2 Zn finger 1004..1023 CDD:275368
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 2/21 (10%)
C2H2 Zn finger 311..331 CDD:275370 2/19 (11%)
zf-C2H2 344..366 CDD:278523 9/21 (43%)
C2H2 Zn finger 346..366 CDD:275368 9/19 (47%)
zf-C2H2 370..392 CDD:278523 9/21 (43%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
zf-H2C2_2 385..408 CDD:290200 11/22 (50%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.