DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and ZNF683

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:XP_006710618.1 Gene:ZNF683 / 257101 HGNCID:28495 Length:533 Species:Homo sapiens


Alignment Length:423 Identity:154/423 - (36%)
Similarity:190/423 - (44%) Gaps:113/423 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 LEAAAAAANACRQ---ANAATPPPTSP--------TEMAYSYKKSQRYGNAVS----------PD 703
            |....:|..||.|   .|..||.| :|        .|.|.|.|.......|.|          |.
Human    75 LAPGRSALLACLQDLDLNLCTPQP-APLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQ 138

  Fly   704 SSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPP------PSHHHHNVIFSP-------SR 755
            :...||:.||:       .||.....|.......||||      ||    .:.|.|       |:
Human   139 NKDKLGKQPER-------AGEGAPCPAFSSHNSSSPPPLQNRKSPS----PLAFCPCPPVNSISK 192

  Fly   756 HAAYLGAGEAGGHSPSPGYP---GYPH---YGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATN 814
            ...:|      .|:..||||   ..||   |||..:.   ..||....|.|.....         
Human   193 ELPFL------LHAFYPGYPLLLPPPHLFTYGALPSD---QCPHLLMLPQDPSYPT--------- 239

  Fly   815 LHLLQTSTQMLNHPLMQPLTPLQRLSPL--------RISPPSSLSPDGNSCPRSGSPLSPNSLAS 871
              :...|..|:.:.|..|....:.|.|.        :..|..:.:|...:.|.....|....:||
Human   240 --MAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMAS 302

  Fly   872 ----------RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKS 926
                      .|..:||||||||:||:.||||:|.|:||||||||||||.|||||||:|.:|.||
Human   303 PAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKS 367

  Fly   927 FTQLAHLQKHHLVHTGEKPHQC--------------------DICKKRFSSTSNLKTHLRLHSGQ 971
            |||||||||||||||||:||:|                    ::|.|||||:||||||||||||.
Human   368 FTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLHSGA 432

  Fly   972 KPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVC 1004
            :|:.|.:|..:|||.:|||||.|||.   |..|
Human   433 RPFQCSVCRSRFTQHIHLKLHHRLHA---PQPC 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 16/19 (84%)
zf-H2C2_2 904..929 CDD:290200 19/24 (79%)
C2H2 Zn finger 920..940 CDD:275368 16/19 (84%)
zf-H2C2_2 932..957 CDD:290200 19/44 (43%)
C2H2 Zn finger 948..968 CDD:275368 15/39 (38%)
zf-H2C2_2 960..985 CDD:290200 15/24 (63%)
C2H2 Zn finger 976..996 CDD:275368 11/19 (58%)
C2H2 Zn finger 1004..1023 CDD:275368 1/1 (100%)
ZNF683XP_006710618.1 COG5048 <326..>448 CDD:227381 75/121 (62%)
zf-C2H2 331..353 CDD:278523 18/21 (86%)
C2H2 Zn finger 333..353 CDD:275368 16/19 (84%)
zf-H2C2_2 345..370 CDD:290200 19/24 (79%)
C2H2 Zn finger 361..381 CDD:275368 16/19 (84%)
C2H2 Zn finger 389..429 CDD:275368 15/39 (38%)
zf-H2C2_2 421..446 CDD:290200 15/24 (63%)
C2H2 Zn finger 437..457 CDD:275368 11/19 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12098
eggNOG 1 0.900 - - E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4354
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D233655at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4128
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.