DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and set-17

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_001317778.1 Gene:set-17 / 174425 WormBaseID:WBGene00011887 Length:277 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:83/208 - (39%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VYLVPDVQAERGLPNR---ADKTLPRSLTLKSSMVYSTPNVKTEGVWSSGVIPRGTRFGPFEGIP 163
            ::.:||...:|...:.   :.:|||....::.|.:   ||... ||.:...||.|..|||::| .
 Worm   108 LFKIPDRVLKRDESSNLSFSQQTLPILFRIEESKL---PNAGL-GVIAEVFIPVGMVFGPYKG-R 167

  Fly   164 TSNYPNDKNKARYFWRVQGTRHITYGNIKIFKDDDYYYLDGSDRSQSNWMRYVASAYSLSVMNLV 228
            ......|..|..|.|.::             ..|..:|:||||..:|||:||:.|.......|::
 Worm   168 RCQKKTDFYKDGYAWLIK-------------SGDKRFYIDGSDAERSNWLRYINSPRFEDEQNML 219

  Fly   229 ACQHQENIYFYTTRDILPNEELMVWYCKDFASRLGYDVDPETTIFGACKQAVEAEEEADEEEEEA 293
            |.|....|::...:.|..|:||:|||...:.:                              |..
 Worm   220 AFQTNGKIFYRVIKPIRINQELLVWYGSSYGN------------------------------EFV 254

  Fly   294 EGEDGKPRYSMPA 306
            |.|:|. :|..||
 Worm   255 ESENGN-KYKKPA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 38/126 (30%)
C2H2 Zn finger 892..912 CDD:275368
zf-H2C2_2 904..929 CDD:290200
C2H2 Zn finger 920..940 CDD:275368
zf-H2C2_2 932..957 CDD:290200
C2H2 Zn finger 948..968 CDD:275368
zf-H2C2_2 960..985 CDD:290200
C2H2 Zn finger 976..996 CDD:275368
C2H2 Zn finger 1004..1023 CDD:275368
set-17NP_001317778.1 PHD_SF 82..>113 CDD:419867 0/4 (0%)
PR-SET_PRDM7_9 128..255 CDD:380970 43/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.