DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and PRDM5

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_001366033.1 Gene:PRDM5 / 11107 HGNCID:9349 Length:641 Species:Homo sapiens


Alignment Length:943 Identity:188/943 - (19%)
Similarity:284/943 - (30%) Gaps:389/943 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LPRSLTLKSSMVYSTPNVKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNK---ARYFWRVQGT 183
            :|...:||||.|..     ..|::::..:.:|.:||||.|  ....|.|.::   .|..|.|:|:
Human     6 VPDRFSLKSSRVQD-----GMGLYTARRVRKGEKFGPFAG--EKRMPEDLDENMDYRLMWEVRGS 63

  Fly   184 RHITYGNIKIFKDDDYYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNE 248
                       |.:..|.||.::...|||:|:|..|.|....||.|.|..|||::....||..:.
Human    64 -----------KGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAVEDIETDT 117

  Fly   249 ELMVWYCKDFASRLGYDVDPETTIFGACKQAVEAEEEADEEEEE-----AEGEDGKPR------- 301
            ||::.|                         ::::.||:|||::     .|||....|       
Human   118 ELLIGY-------------------------LDSDMEAEEEEQQIMTVIKEGEVENSRRQSTAGR 157

  Fly   302 ---------YSMPAPE---IPPDVAVSHITYVMGLHLPVGAGNGPANGSVAGSVSGATPPPPTAT 354
                     |:.|..|   ...|:...|:   ..||                             
Human   158 KDRLGCKEDYACPQCESSFTSEDILAEHL---QTLH----------------------------- 190

  Fly   355 PCCRRSSPPAHVSTTTSTCNAHHP-------HIQHGRHASVIIGQDRSPMASSDKDTAGSPLSGL 412
                 ..|..........|....|       |:......|.:....||...|....:..|..|..
Human   191 -----QKPTEEKEFKCKNCGKKFPVKQALQRHVLQCTAKSSLKESSRSFQCSVCNSSFSSASSFE 250

  Fly   413 DHQMTPQDGSVRSV-----------------RSDEGYHSNE---------CHEDGLTPPEDSSDS 451
            .||.|.: |..|.|                 |..|..|:.:         |::..     .|:.|
Human   251 QHQETCR-GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKC-----SSASS 309

  Fly   452 ESEHNYV------LDCSKKAIAPKETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTATPICET 510
            ..||..:      .:|.||.|:                     ||.....||:||....:|:.  
Human   310 LQEHRKIHEIFDCQECMKKFIS---------------------ANQLKRHMITHSDMRLSPLI-- 351

  Fly   511 DKNEYRKFKV-KMPLKYEFKNKTCVKQEPSLKEVDQEMSLPQEEEEDQVMHPEPDSICPSTTTHL 574
                   |.: |.|...|..||       |.|.:||..:......||:   |....:|..     
Human   352 -------FLIEKRPYNCEICNK-------SFKRLDQVGAHKVIHSEDK---PYKCKLCGK----- 394

  Fly   575 GDEHMLMMERERERERE----RIQEREPSNQQPASSTVIVLEHNSGGQARTIVPLSKPYYEPDPP 635
            |..|..:.:..::...|    :.:|.:...:.|.|....:|.|||                    
Human   395 GFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHLLIHNS-------------------- 439

  Fly   636 GERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGNAV 700
             ||..:                            |...:|             ::|:.       
Human   440 -ERTFK----------------------------CHHCDA-------------TFKRK------- 455

  Fly   701 SPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAAYLGAGEA 765
                        :.|:....||.|                              ||..|      
Human   456 ------------DTLNVHVQVVHE------------------------------RHKKY------ 472

  Fly   766 GGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLM 830
                                                                   ..::.|...:
Human   473 -------------------------------------------------------RCELCNKAFV 482

  Fly   831 QPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVC 895
            .|       |.||....:........||..|     ...||.|  :|...::...|:..|:|..|
Human   483 TP-------SVLRSHKKTHTGEKEKICPYCG-----QKFASSG--TLRVHIRSHTGERPYQCPYC 533

  Fly   896 CKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSN 960
            .|.|.:...||:|:|||:.|:|:||:.|:|:|:|...|.:|...||||||.|||:|...||....
Human   534 EKGFSKNDGLKMHIRTHTREKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKM 598

  Fly   961 LKTHLRLHSGQKPYA-CDLCPQKFTQFVHLKLH 992
            |..|...|:..:|.| |..|.:|||:..:||:|
Human   599 LIRHKMTHNPNRPLAECQFCHKKFTRNDYLKVH 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 37/129 (29%)
C2H2 Zn finger 892..912 CDD:275368 8/19 (42%)
zf-H2C2_2 904..929 CDD:290200 13/24 (54%)
C2H2 Zn finger 920..940 CDD:275368 7/19 (37%)
zf-H2C2_2 932..957 CDD:290200 13/24 (54%)
C2H2 Zn finger 948..968 CDD:275368 7/19 (37%)
zf-H2C2_2 960..985 CDD:290200 9/25 (36%)
C2H2 Zn finger 976..996 CDD:275368 8/17 (47%)
C2H2 Zn finger 1004..1023 CDD:275368
PRDM5NP_001366033.1 PR-SET_PRDM5 2..128 CDD:380967 42/164 (26%)
COG5048 <145..338 CDD:227381 39/256 (15%)
C2H2 Zn finger 169..190 CDD:275368 4/23 (17%)
C2H2 Zn finger 201..221 CDD:275368 3/19 (16%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
COG5048 262..631 CDD:227381 114/604 (19%)
C2H2 Zn finger 264..287 CDD:275368 2/22 (9%)
C2H2 Zn finger 297..317 CDD:275368 5/24 (21%)
C2H2 Zn finger 322..342 CDD:275368 8/40 (20%)
C2H2 Zn finger 361..381 CDD:275368 7/26 (27%)
C2H2 Zn finger 389..409 CDD:275368 3/24 (13%)
C2H2 Zn finger 417..437 CDD:275368 4/19 (21%)
C2H2 Zn finger 445..462 CDD:275368 4/48 (8%)
C2H2 Zn finger 474..494 CDD:275368 5/26 (19%)
C2H2 Zn finger 502..522 CDD:275368 7/26 (27%)
C2H2 Zn finger 530..550 CDD:275368 8/19 (42%)
C2H2 Zn finger 558..578 CDD:275368 7/19 (37%)
C2H2 Zn finger 586..606 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..636 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.