DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eaf6 and B0025.4

DIOPT Version :10

Sequence 1:NP_647981.1 Gene:Eaf6 / 38637 FlyBaseID:FBgn0035624 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_740860.2 Gene:B0025.4 / 172279 WormBaseID:WBGene00015001 Length:148 Species:Caenorhabditis elegans


Alignment Length:70 Identity:18/70 - (25%)
Similarity:31/70 - (44%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 DKIVKEMNRMEAFKIALTTWSKWIDHN-IDPSKTRVFYQGVSPVHLNGGEWGKPGKTCLGETVPV 279
            |.:....|::|...:.|:..|...|.| :|...|.:|..|  .:| :..|.    :..|.|:|..
 Worm   155 DYVRSLQNQIEFLSMKLSAASACYDLNSLDIEPTDIFQGG--NIH-SAAEM----ERILRESVGT 212

  Fly   280 QGPSY 284
            |.|::
 Worm   213 QPPNF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eaf6NP_647981.1 NuA4 37..116 CDD:462763
B0025.4NP_740860.2 NuA4 13..95 CDD:462763
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.