DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl2 and Adgrl1

DIOPT Version :10

Sequence 1:NP_788462.2 Gene:mthl2 / 38636 FlyBaseID:FBgn0035623 Length:518 Species:Drosophila melanogaster
Sequence 2:XP_038953894.1 Gene:Adgrl1 / 65096 RGDID:620768 Length:1472 Species:Rattus norvegicus


Alignment Length:298 Identity:75/298 - (25%)
Similarity:123/298 - (41%) Gaps:48/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 LQHRTFGEGNNNSIRIIPHNCLILPSRTGQTVVMITSLICLVLTIAVYLCVKKLMNLEGKCFICY 255
            :.||...:|..|.        |:|...|  .|.::.||:||.:.|:.:..::.|...........
  Rat   845 MAHREIYQGRINE--------LLLSVIT--WVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNL 899

  Fly   256 MMCLFFGYLFLLLDL----WELSLDFCKA-AGFLGYFFVMAAFFWLSIISRHYWKCLTNPCASMN 315
            .:.||...|..|:.:    :|::   |.. ||.|.||| :|||.||.:...|.:..|.....|..
  Rat   900 CINLFLAELLFLVGIDKTQYEVA---CPIFAGLLHYFF-LAAFSWLCLEGVHLYLLLVEVFESEY 960

  Fly   316 IRSERAFLLYSCFAWAMPLALTGVTYLADNVVNNEEWQPRVGDEGHCWIYTKS---WSAMVYFYG 377
            .|::..:|...||    |..:.|:....|        ....|.|..||:...:   ||    |.|
  Rat   961 SRTKYYYLGGYCF----PALVVGIAAAID--------YRSYGTEKACWLRVDNYFIWS----FIG 1009

  Fly   378 PMVLLILFNITMFVLTAKHIIDSKRTLRKIARNEGRIQKLNSDKQNYTQFLLLFTVMGMSWSFEI 442
            |:..:|:.|:...::|...:|.|...|:.   :..|:..:.|........|.|   :|::|:|.:
  Rat  1010 PVSFVIVVNLVFLMVTLHKMIRSSSVLKP---DSSRLDNIKSWALGAIALLFL---LGLTWAFGL 1068

  Fly   443 FSYLVQREKLWVNIFLVADYFNWSQGVIIFVLFILRRK 480
            .  .:.:|.: |..:|... ||..|||.|||.....:|
  Rat  1069 L--FINKESV-VMAYLFTT-FNAFQGVFIFVFHCALQK 1102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl2NP_788462.2 Methuselah_N 31..211 CDD:429053 4/19 (21%)
7tmB3_Methuselah-like 215..489 CDD:410632 69/274 (25%)
TM helix 1 215..240 CDD:410632 7/24 (29%)
TM helix 2 249..269 CDD:410632 4/19 (21%)
TM helix 3 279..306 CDD:410632 12/27 (44%)
TM helix 4 322..342 CDD:410632 5/19 (26%)
TM helix 5 367..397 CDD:410632 8/32 (25%)
TM helix 6 419..446 CDD:410632 6/26 (23%)
TM helix 7 454..479 CDD:410632 10/24 (42%)
Adgrl1XP_038953894.1 Gal_Rha_Lectin_LPHN1 35..131 CDD:438701
OLF 143..399 CDD:470611
PHA03247 <399..483 CDD:223021
HormR 477..540 CDD:214468
GAIN 550..774 CDD:465137
GPS 798..850 CDD:197639 2/4 (50%)
7tmB2_Latrophilin-1 857..1114 CDD:320673 71/286 (25%)
TM helix 1 859..884 CDD:320673 8/26 (31%)
TM helix 2 893..915 CDD:320673 4/21 (19%)
TM helix 3 924..951 CDD:320673 12/27 (44%)
TM helix 4 963..983 CDD:320673 5/23 (22%)
TM helix 5 1000..1029 CDD:320673 8/32 (25%)
TM helix 6 1045..1072 CDD:320673 6/31 (19%)
TM helix 7 1076..1101 CDD:320673 10/26 (38%)
Latrophilin 1113..1472 CDD:460538
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.