DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B28

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_172768.1 Gene:CYP71B28 / 837866 AraportID:AT1G13090 Length:490 Species:Arabidopsis thaliana


Alignment Length:491 Identity:113/491 - (23%)
Similarity:199/491 - (40%) Gaps:107/491 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KYTQAPGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLN 115
            |:...|||:..|||||||   :.|:........|:::||.|..|.:|....:|:::.|...|||.
plant    25 KWKLPPGPKKLPIIGNLH---QRRELHPRNSRNLSEKYGPIVFLRYGFVPVVVISSKEAAEEVLK 86

  Fly   116 QNGKVMSGRPD-----FIRYH-KLFG----GERSNSLALCDWSQLQQKRRNLARRHCSPREFSCF 170
            .:......||:     .|.|: |..|    ||        ||..:  ::.::.....|.:..|..
plant    87 THDLECCSRPETVGTRAISYNFKDIGFAPYGE--------DWRTM--RKLSVVELFSSKKLQSFR 141

  Fly   171 YMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRF----------DYD 225
            |::.     ||.:...::|.:.......:|::    |....:....:|.:.|          |.|
plant   142 YIRE-----EENDLCVKKLSDLASRRSLVNLE----KTLFTLVGSIVCRIGFGINLRECEFVDED 197

  Fly   226 DVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELS-V 289
            .:|  .:|...:::   |......||.|.|       :.::|.|      ...||...:|..| |
plant   198 SID--DLVHKSEDV---IRNSIFSDFFPGL-------MGRLIEW------IFSERKRLNRLYSEV 244

  Fly   290 D------LDE---PDRDFTDAL--LKSLLEDKDVSRNTIIF-------MLED-FIGGHSAVGNLV 335
            |      ||:   |.|:.:|.:  :..:::.::...::..|       |:.| |:.|.......:
plant   245 DTFFQNILDDHLKPGRESSDIIDVMIDMMKKQEKEGDSFKFTTDHLKGMISDIFLAGVGTSSTTL 309

  Fly   336 MLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVA 398
            :..:..:.:|..:.:::|:||...:.::...|...|:|.:.|....:.|:.| :.::| ::|...
plant   310 IWAMTELIRNPRVMKKVQDEIRTTLGDKKERITEEDLNQLHYFKLMVKEIFRLHPAAPLLLPRET 374

  Fly   399 TEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDN 463
            .....|.||.:...|.:.||.|.:....|.|.||.||||.|||              ||.|:...
plant   375 LSHVKIQGYDIPAKTQIMINAYAIARDPKLWTNPDEFNPDRFL--------------DSSIDYRG 425

  Fly   464 EKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVV 499
            ...:|       |||..|:|.|.|..:    |..:|
plant   426 LNFEL-------LPFGSGRRICPGMTM----GIAIV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 112/486 (23%)
CYP71B28NP_172768.1 CYP71-like 58..474 CDD:410695 100/455 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.