DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B2

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_172767.1 Gene:CYP71B2 / 837865 AraportID:AT1G13080 Length:502 Species:Arabidopsis thaliana


Alignment Length:533 Identity:111/533 - (20%)
Similarity:199/533 - (37%) Gaps:98/533 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRYR 74
            :.|||.....|.:.|:              :|..:..|...|:...|.|...|||||||.|   .
plant     1 MTILLCFFLVSLLTIV--------------SSIFLKQNKTSKFNLPPSPSSLPIIGNLHHL---A 48

  Fly    75 DSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFGGERS 139
            ..|...|..|:.:||.:..|..|....:|:::.|....||..|......||..:...||..|.: 
plant    49 GLPHRCFHKLSIKYGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFK- 112

  Fly   140 NSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQ----IGCEEMEHWNRELGNQLVPGEPIN 200
             .:....:.:..::.|.||       ....|..|..|    |..||::...:::....:...|::
plant   113 -DITFAPYGEYWREVRKLA-------VIELFSSKKVQSFRYIREEEVDFVVKKVSESALKQSPVD 169

  Fly   201 IKPLILKACANMFSQYMCSLRFDYDD--VDFQQIVQYFDE--------IFWEINQGHPLDFLPWL 255
            :........|::..:......|:...  :|..:|.:...|        .|.:...|....|:.||
plant   170 LSKTFFSLTASIICRVALGQNFNESGFVIDQDRIEELVTESAEALGTFTFSDFFPGGLGRFVDWL 234

  Fly   256 YPFYQRH--LNKIINWSSTIRGFIMERIIRHRE---------LSVDLDEPDRDFTDALLKSLLED 309
               :|||  :||:.   ..:..|....|..|.:         :::.||..|:.          ||
plant   235 ---FQRHKKINKVF---KELDAFYQHVIDDHLKPEGRKNQDIVTLILDMIDKQ----------ED 283

  Fly   310 KDVSR----NTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLL 370
            .|..:    |....:::.|:.|.......::..:..:.:|..:.::.||.|...:..:...|...
plant   284 SDSFKLNMDNLKAIVMDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERITEE 348

  Fly   371 DMNAMPYTMATIFEVLRYSSSPIVPHVATEDTV----ISGYGVTKGTIVFINNYVLNTSEKFWVN 431
            |:..:.|....:.|..|.  .|.:|.|...:|:    |.||.:...|.:.:|.:.:....|.|.:
plant   349 DLGKVEYLNHILKETFRL--HPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWND 411

  Fly   432 PKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGF 496
            |:||||.||              ::|.::...:...|       |||..|:|.|.|..:......
plant   412 PEEFNPERF--------------ANSSVDFRGQHFDL-------LPFGSGRRICPGMPMAIASVE 455

  Fly   497 LVVVNVMQRYNIS 509
            |.::|::..::.|
plant   456 LALMNLLYYFDWS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 103/487 (21%)
CYP71B2NP_172767.1 p450 5..500 CDD:386267 109/529 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.