DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B13

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_197896.1 Gene:CYP71B13 / 832585 AraportID:AT5G25140 Length:496 Species:Arabidopsis thaliana


Alignment Length:508 Identity:110/508 - (21%)
Similarity:196/508 - (38%) Gaps:108/508 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLV 103
            ||:.:...|.      .|||...|||||||.|.   ..|......|:::||.:..|..|....:|
plant    20 KNTRKTKKNL------PPGPPRLPIIGNLHQLG---SKPHRSMFKLSEKYGPLVYLKLGKVPSVV 75

  Fly   104 VNNLELIREVLNQNGKVMSGR-----PDFIRYHKLFGGERSNSLALCDWS------------QLQ 151
            .:..|.:::||....|....|     |..|.|:       ...||...:|            :|.
plant    76 ASTPETVKDVLKTFDKDCCSRAFLTYPARISYN-------LKDLAFAPYSKYWKAVRKMTVVELY 133

  Fly   152 QKRRNLARRHCSPREFSCF--YMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFS 214
            ..:|..:.|:....|.:.|  ::|.| ...||:                :|:...::|...::  
plant   134 TAKRVKSFRNIREEEVASFVEFIKHS-ASLEEI----------------VNLNQTLVKLSGSV-- 179

  Fly   215 QYMCSLRFDYD------DVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQR----HLNKIINW 269
              :|.:.|..:      :..:::::....|:.......   |:.|.:.....|    | ||....
plant   180 --ICRVGFGINLEGSKLENTYEEVIHGTMEVLGSFAAS---DYFPVIGGIIDRITGLH-NKCEKV 238

  Fly   270 SSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLK------SLLEDKDVSRNTIIFMLEDFIGGH 328
            ......|....|..|.|.....|    |..|.|||      .|.|.:....:|...:|:..:.|.
plant   239 FKGTDSFFDHCIKHHLEDGGSKD----DIVDLLLKVERGEIGLGEFQFTRNHTKGILLDILLAGV 299

  Fly   329 SAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPI 393
            ...|:.:..|:.::.||..:.::.|.|:..:|:.:: :|...|:..:.|....:.|.||.  :|:
plant   300 DTSGHTITWVMTHLIKNPRVMKKAQAEVREVIKNKD-NITEEDIEGLEYLKMVVKETLRI--NPL 361

  Fly   394 V----PHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKG 454
            |    |..|::|..|.||.:.|.|.:.:|.:.::.:...|.:|:.|.|.||:             
plant   362 VPLLTPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFM------------- 413

  Fly   455 SDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYN 507
             |:.|:......:|       |||..|:|.|.|..:......|.::|::.|::
plant   414 -DNQIDYKGLNFEL-------LPFGSGRRICPGIGMGMALIHLTLINLLYRFD 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 107/491 (22%)
CYP71B13NP_197896.1 p450 1..490 CDD:299894 110/508 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.