DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP81F4

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_195457.1 Gene:CYP81F4 / 829895 AraportID:AT4G37410 Length:501 Species:Arabidopsis thaliana


Alignment Length:502 Identity:113/502 - (22%)
Similarity:206/502 - (41%) Gaps:90/502 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QKYTQAPGPR-PWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREV 113
            |:|...|.|. ..||:|: |||  .:......|..|:..:|.|:.|..|..|.:|:::..|.||.
plant    26 QRYYLPPSPSYSLPILGH-HLL--IKPPVHRLFHRLSNIHGPIFYLRLGSRRAVVISSSSLAREC 87

  Fly   114 L-NQNGKVMSGRPDF-----IRYH------KLFGGERSNSLALCDWSQLQQKRRNLARRHCSPRE 166
            . .||..::|.||.|     |.|:      ..:|....|...:|....:..||  ||        
plant    88 FTGQNDVIVSNRPRFLTSKYIAYNYTTIATTSYGDHWRNLRRICSLEIVSSKR--LA-------- 142

  Fly   167 FSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQ 231
                  ....|..||::.....|......|:.:.::.::.....|...:.:....:..|||..::
plant   143 ------NFLHIRKEEIQRMLTRLSRDARVGKEVELESILYDLTFNNIVRMVTGKIYYGDDVSDKE 201

  Fly   232 IVQYFDEIFWEI--NQG--HPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERI----------- 281
            ..:.|.::|..|  |.|  ||.::||:: ..:.....|.:..::.:...:::|:           
plant   202 EAELFKKLFTFITTNSGARHPGEYLPFM-KIFGGSFEKEVKAAAKVIDEMLQRLLDECKSDKDGN 265

  Fly   282 --IRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAK 344
              :.|. ||:..|:|:. :||.::|.|             ||...:.........:...:|.:..
plant   266 TMVNHL-LSLQQDDPEY-YTDIIIKGL-------------MLGIMVASSETSALTIEWAMASLLN 315

  Fly   345 NVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSPI-VPHVATEDTVISGY 407
            :..:..:::.|||.||.:: |.|...|:..:||....:.|.|| :.::|: ||....||..|.||
plant   316 HPKVLDKVKLEIDEIIGQD-RLIEESDIANLPYLQNVVSETLRLHPAAPVLVPRSTAEDIKIGGY 379

  Fly   408 GVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNI 472
            .|.:.|:|.:|.:.::.....|..|:.|||.||                :|.|.:.:.:::    
plant   380 DVPRDTMVMVNAWAIHRDPDLWTEPERFNPERF----------------NGGEGEKDDVRM---- 424

  Fly   473 PHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKIS 519
              .:.|..|:|.|.|..|......|.:.:::|.::....|...|.:|
plant   425 --LIAFGSGRRICPGVGLAHKIVTLALGSLIQCFDWKKVNEKEIDMS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 111/496 (22%)
CYP81F4NP_195457.1 CYP81 63..482 CDD:410746 101/462 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.