DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP81D3

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_195451.1 Gene:CYP81D3 / 829889 AraportID:AT4G37340 Length:500 Species:Arabidopsis thaliana


Alignment Length:602 Identity:138/602 - (22%)
Similarity:223/602 - (37%) Gaps:198/602 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPW--PIIGNL 67
            ||:|.|.|.||:     ..||..:|||...|                    |.| .|  |:||:|
plant     6 LIFTFLFISLSL-----TFIIGRIKRRPNLP--------------------PSP-SWALPVIGHL 44

  Fly    68 HLLDRYRDSPFAGFTALAQQYGD--IYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRY 130
            .||   :......|.::::..||  |.||..|:....||::..|..|...:|..|::        
plant    45 RLL---KPPLHRVFLSVSESLGDAPIISLRLGNRLVFVVSSHSLAEECFTKNDVVLA-------- 98

  Fly   131 HKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWN--RELGN-Q 192
                  .|.||               ||.:|.|   :.|..:..:..|    :||.  |.:|. :
plant    99 ------NRFNS---------------LASKHIS---YGCTTVVTASYG----DHWRNLRRIGAVE 135

  Fly   193 LVPGEPIN---------IKPLILKACANMFSQYMCSLRFD-------YDDVDFQQIVQ------- 234
            :.....:|         |..||  ||.:..|    ||.|.       :.::.|..|::       
plant   136 IFSAHRLNSFSSIRRDEIHRLI--ACLSRNS----SLEFTKVEMKSMFSNLTFNNIIRMLAGKCY 194

  Fly   235 YFD------------EIFWE----INQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIR 283
            |.|            |:..|    ...|:..|:||            |:.|   |.|  .|:  |
plant   195 YGDGAEDDPEAKRVRELIAEGMGCFGAGNTADYLP------------ILTW---ITG--SEK--R 240

  Fly   284 HRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTII---------------------FMLEDFIGG 327
            .::::..|||    |...|:....|.|:..:||::                     .||...:.|
plant   241 IKKIASRLDE----FLQGLVDERREGKEKRQNTMVDHLLCLQETQPEYYTDNIIKGIMLSLILAG 301

  Fly   328 HSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSS 391
            .......:...|:.:..:..|..:.::|||..: ..||.:...|::.:||....:.|.|| |.:|
plant   302 TDTSAVTLEWTLSALLNHPQILSKARDEIDNKV-GLNRLVEESDLSHLPYLQNIVSESLRLYPAS 365

  Fly   392 P-IVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGS 455
            | :|||||:||..:.||.:.:||::..|.:.::...|.|.:|..|.|.||               
plant   366 PLLVPHVASEDCKVGGYHMPRGTMLLTNAWAIHRDPKIWDDPTSFKPERF--------------- 415

  Fly   456 DSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIK--- 517
                |.:.|..:|       |.|.:|:|.|.|..|.:....|.:.:::|.:.........:.   
plant   416 ----EKEGEAQKL-------LGFGLGRRACPGSGLAQRLASLTIGSLIQCFEWERIGEEEVDMTE 469

  Fly   518 -----ISPESLALPADC 529
                 |.|:::.|.|.|
plant   470 GGGGVIMPKAIPLVAMC 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 125/551 (23%)
CYP81D3NP_195451.1 p450 5..489 CDD:299894 138/602 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.