DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B25

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_189258.1 Gene:CYP71B25 / 822230 AraportID:AT3G26270 Length:501 Species:Arabidopsis thaliana


Alignment Length:513 Identity:114/513 - (22%)
Similarity:211/513 - (41%) Gaps:101/513 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDRYR 74
            :|||.|.|....:..::.:       :.||...|...|.      .|||...||:||||.|.   
plant     1 MAILQSFLLLLSLPFLFTL-------IYTKKMKESKRNL------PPGPAKLPIVGNLHQLQ--- 49

  Fly    75 DSPFAGFT-----ALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPD------FI 128
                 |..     .|::::|.:..|..|....:::::.|...|.|..:......||:      |.
plant    50 -----GMVHRCLHELSKKHGPVMHLQLGFVPLVLISSSEAAEEALKTHDIECCTRPNTNAARVFS 109

  Fly   129 RYHKLFG-GERSNSLALCDWSQLQQKRRNLARRHCSPREFSCF-YMKMSQIGCEEMEH-WNRELG 190
            |.:|..| |..|:     :|.:|   |:...|.:.|.::...| |::      ||..| ..::|.
plant   110 RNNKNIGLGAYSD-----EWREL---RKVAVREYFSVKKVQSFRYVR------EEENHLMVKKLR 160

  Fly   191 NQLVPGEPINI-KPLILKACANMF-----SQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPL 249
            :..:...|::: |.|...|.:.:|     ..:..:..|..:.:: :.:.:....:.::.:...|:
plant   161 DLALKQSPVDLSKTLFCLAASTVFRPVFGQSFSDNKHFSEEKIE-ELVFEAQKSLTFKFSDLFPI 224

  Fly   250 DFLPWLYPF---YQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLL---- 307
            ..|.|...|   ..:.|:|:.   ..:..|:...|..|::.:...|..|      ::.|||    
plant   225 PGLGWFIGFVSGQHKGLHKVF---IEVDNFLNHMIDDHQKQNQPQDRSD------IVGSLLDMIH 280

  Fly   308 -EDKDVSRNTIIFMLED-----FIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRS 366
             :::|.|....|..|:.     |:.|.......::..:|.:..|..:.:::|:||.:.|..:...
plant   281 NQEQDKSFKLTIDHLKGITQDIFLAGIDTSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKER 345

  Fly   367 INLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFW 429
            |...|:..:.|....|.|.|| :.::| ::|.....|..|.||.:.:.|::.::.:.|....|:|
plant   346 IEEEDVGKLQYLKLVIKETLRLHPAAPLLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYW 410

  Fly   430 VNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIG 487
            .||:||||.||::     .|.:.||...                .||||..|:|.|.|
plant   411 KNPEEFNPERFID-----CPVDYKGHSF----------------EFLPFGSGRRFCPG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 105/467 (22%)
CYP71B25NP_189258.1 p450 26..497 CDD:299894 107/481 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.