DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B22

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_189251.1 Gene:CYP71B22 / 822221 AraportID:AT3G26200 Length:500 Species:Arabidopsis thaliana


Alignment Length:522 Identity:125/522 - (23%)
Similarity:203/522 - (38%) Gaps:97/522 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||...|||||||.|.:   |....|..|:|.||.:..|.||....:||:..|...|||..:...
plant    30 PGPLGLPIIGNLHQLGK---SLHRSFHKLSQNYGPVMFLHFGVVPVVVVSTREAAEEVLKTHDLE 91

  Fly   121 MSGRPDFIRYHKLFG-----------GERSNSLALCDWSQLQQKRRNLARRHC-SPREFSCF-YM 172
            ...||. :...|||.           |:        ||.::    |.||.... |.::...| |:
plant    92 TCTRPK-LTATKLFSYNYKDIGFAQYGD--------DWREM----RKLAMLELFSSKKLKAFRYI 143

  Fly   173 KMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRF--DYDDVDFQQIVQY 235
            :         |..:..|.|:|...........:.||..:..:..:|.|.|  ::.:.||..:.:.
plant   144 R---------EEESEVLVNKLSKSAETRTMVDLRKALFSYTASIVCRLAFGQNFHECDFVDMDKV 199

  Fly   236 FDEIF-WEINQGH--PLDFLP----WLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDE 293
            .|.:. .|.|.|.  ..||.|    |:........:::....:.:..|....|..|  |.....:
plant   200 EDLVLESETNLGSFAFTDFFPAGLGWVIDRISGQHSELHKAFARLSNFFQHVIDDH--LKPGQSQ 262

  Fly   294 PDRDFTDALLKSLLEDKDVSRNTIIF------MLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRI 352
            ...|....:|..:.::..|....:.:      |.:.|:.|.:|....::..:..:|::..:.:::
plant   263 DHSDIIGVMLDMINKESKVGSFQVTYDHLKGVMSDVFLAGVNAGAITMIWAMTELARHPRVMKKL 327

  Fly   353 QEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGYGVTKGTIV 415
            |:||..|:.:....|...|:..:.|....|.|..| :..:| ::|.....|..|.||.:.|.|::
plant   328 QQEIREILGDNKEKITEQDLEKVHYLKLVIEETFRLHPPAPLLLPRETMSDLKIQGYNIPKNTMI 392

  Fly   416 FINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHF--LPF 478
            .||.|.:......|.||.:|||.||::     ||...||.                  |:  |||
plant   393 EINTYSIGRDPNCWENPNDFNPERFID-----SPVEYKGQ------------------HYELLPF 434

  Fly   479 SIGKRTCIGQNLVRGFGFLVV----VNVMQRYNISSHNPSTIKISPESLA-----LPADCFPLVL 534
            ..|:|.|.|.    ..|..:|    :||:..::.|.  |..:||....:.     :.|...||.|
plant   435 GAGRRICPGM----ATGITIVELGLLNVLYFFDWSL--PDGMKIEDIDMEEAGAFVVAKKVPLEL 493

  Fly   535 TP 536
            .|
plant   494 IP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 125/522 (24%)
CYP71B22NP_189251.1 CYP71-like 59..491 CDD:410695 106/484 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.