DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP71B21

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_189250.1 Gene:CYP71B21 / 822220 AraportID:AT3G26190 Length:499 Species:Arabidopsis thaliana


Alignment Length:520 Identity:120/520 - (23%)
Similarity:200/520 - (38%) Gaps:93/520 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||...|||||||.|.:   |....|..|:|:||.:..|.||....:|.:..|...|||..:...
plant    30 PGPISLPIIGNLHQLGK---SLHRSFYKLSQEYGPVMFLRFGVVPVVVFSTKEAAEEVLKTHDLE 91

  Fly   121 MSGRP---------------DFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHC-SPREFSC 169
            ...||               .|.:|     ||        ||.::    |.||.... |.::...
plant    92 TCTRPKLSATGLFTYNFKDIGFAQY-----GE--------DWREM----RKLAMLELFSSKKLKA 139

  Fly   170 F-YMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRF-----DYDDVD 228
            | |::.     ||.|...:::.........::::    ||..:..:..:|.|.|     :.|.||
plant   140 FRYIRE-----EESELLVKKVTESAQTQTLVDLR----KALFSYTASIVCRLAFGQNFHECDFVD 195

  Fly   229 FQQIVQYFDEIFWEINQGHPLDFLP----WLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSV 289
            ..::.:...|....:.....:||.|    |.........:::....:.:..|....|..|  |..
plant   196 MDKVEELVLESETNLGSFAFIDFFPAGLGWAIDRISGQHSRLHKAFARLSNFFQHVIDDH--LKP 258

  Fly   290 DLDEPDRDFTDALLKSLLEDKDVSRNTIIF------MLEDFIGGHSAVGNLVMLVLAYIAKNVDI 348
            ...|...|....:|..:.::..|....:.:      |.:.|:.|.:|....::..|..:.::..:
plant   259 WQSEDHSDIVGVMLDMINKESKVGSFKVTYDHLKGVMSDVFLAGVNAGAITMIWALTELTRHPRV 323

  Fly   349 GRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSP-IVPHVATEDTVISGYGVTK 411
            .:::|:||..::.:....|...|:..:.|....|.|..| :..:| ::|.....|..|.||.:.|
plant   324 MKKLQQEIRELLGDNKEKITEQDLEKVHYLKLVIQETFRLHPPAPLLLPRETMSDVKIQGYNIPK 388

  Fly   412 GTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHF- 475
            .|::.||.|.:......|.||.||.|.||::     ||.:.||.                  || 
plant   389 NTMIEINTYAIGRDPNCWTNPNEFIPERFVD-----SPIDYKGQ------------------HFE 430

  Fly   476 -LPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNIS-SHNPSTIKISPESLA--LPADCFPLVLTP 536
             |||..|:|.|.|.........|.::||:..::.| .:..:...|:.|...  :.|...||.|.|
plant   431 LLPFGGGRRICPGMATGMTIVELGLLNVLYFFDWSLPYGMAIADINMEEAGAFVIAKKVPLELVP 495

  Fly   537  536
            plant   496  495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 120/520 (23%)
CYP71B21NP_189250.1 p450 27..498 CDD:299894 120/520 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.