DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP78A6

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_182189.1 Gene:CYP78A6 / 819278 AraportID:AT2G46660 Length:530 Species:Arabidopsis thaliana


Alignment Length:533 Identity:131/533 - (24%)
Similarity:232/533 - (43%) Gaps:109/533 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIYTILAILLSVLATSYIC-----------IIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGP 58
            |.:::||:.:..||.|...           .::|  |.:....||.|             ..|||
plant    25 LAFSLLAVTIIWLAISLFLWTYPGGPAWGKYLFG--RLISGSYKTGN-------------VIPGP 74

  Fly    59 RPWPIIGNLHLLD------RYRDSPFAGFTALAQQYG--DIYSLTFGHTRCLVVNNLELIREVLN 115
            :.:|::|::.|:.      |..|:        |:::|  .:.:.:.|.||.:|..|.::.:|:| 
plant    75 KGFPLVGSMSLMSSTLAHRRIADA--------AEKFGAKRLMAFSLGETRVIVTCNPDVAKEIL- 130

  Fly   116 QNGKVMSGRPDFIR---YHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQ- 176
             |..|.:.||  ::   |..:|    :.::.........:..|.:|..|.    ||...::.:: 
plant   131 -NSPVFADRP--VKESAYSLMF----NRAIGFAPHGVYWRTLRRIASNHL----FSTKQIRRAET 184

  Fly   177 ----IGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSL-----RFDYDDVDFQQI 232
                |..:.:|...::..|     ||..::.|:..|..|   ..|||:     ..:.:.|:.:::
plant   185 QRRVISSQMVEFLEKQSSN-----EPCFVRELLKTASLN---NMMCSVFGQEYELEKNHVELREM 241

  Fly   233 VQYFDEIFWEINQGHPLDFLPWLYPF-YQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDR 296
            |:...::...:|.   .|.||||..| .||..::.......:..|:...|..||..:.||   .|
plant   242 VEEGYDLLGTLNW---TDHLPWLSEFDPQRLRSRCSTLVPKVNRFVSRIISEHRNQTGDL---PR 300

  Fly   297 DFTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIE 361
            ||.|.||.....||....:.|..:.|....|...|..|:..:||.:..:.|:...:|.|:|.:: 
plant   301 DFVDVLLSLHGSDKLSDPDIIAVLWEMIFRGTDTVAVLIEWILARMVLHPDMQSTVQNELDQVV- 364

  Fly   362 EENRSINLLDMNAMPYTMATIFEVLR-YSSSPIV--PHVATEDTVISGYGVTKGTIVFINNYVLN 423
            .::|:::..|:.::||..|.:.|||| :...|::  ..:|..||::.|..|..||...:|.:.::
plant   365 GKSRALDESDLASLPYLTAVVKEVLRLHPPGPLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVS 429

  Fly   424 TSEKFWVNPKEFNPLRFLEPSKEQSPKNS-KGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIG 487
            .....||:|.||.|.||:  :||...:.| .|||         |:|       .||..|:|.|.|
plant   430 HDPHVWVDPLEFKPERFV--AKEGEVEFSVLGSD---------LRL-------APFGSGRRICPG 476

  Fly   488 QNLVRGFGFLVVV 500
            :||    ||..|:
plant   477 KNL----GFTTVM 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 120/471 (25%)
CYP78A6NP_182189.1 p450 25..523 CDD:386267 131/533 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.