DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and CYP98A3

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_850337.1 Gene:CYP98A3 / 818686 AraportID:AT2G40890 Length:508 Species:Arabidopsis thaliana


Alignment Length:490 Identity:119/490 - (24%)
Similarity:199/490 - (40%) Gaps:98/490 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KYTQAPGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLN 115
            :|...|||.|.||:|||:.:...|   |..:...||.||.|.|:..|....:||::.||.:|||.
plant    24 RYKFPPGPSPKPIVGNLYDIKPVR---FRCYYEWAQSYGPIISVWIGSILNVVVSSAELAKEVLK 85

  Fly   116 QNGKVMSGR----------------------PDFIRYHK-----LFGGERSNSLALCDWSQLQQK 153
            ::.:.::.|                      |.:::..|     ||..:|..||......::...
plant    86 EHDQKLADRHRNRSTEAFSRNGQDLIWADYGPHYVKVRKVCTLELFTPKRLESLRPIREDEVTAM 150

  Fly   154 RRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMC 218
            ..::. |.|:..|                   ||..|.||        :..:.....|..::...
plant   151 VESVF-RDCNLPE-------------------NRAKGLQL--------RKYLGAVAFNNITRLAF 187

  Fly   219 SLRF-------DYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGF 276
            ..||       |...::|:.||....::...::....:.:|.|::|..::...:.......:...
plant   188 GKRFMNAEGVVDEQGLEFKAIVSNGLKLGASLSIAEHIPWLRWMFPADEKAFAEHGARRDRLTRA 252

  Fly   277 IMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVSRNTIIFMLEDFI-GGHSAVGNLVMLVLA 340
            |||.....|:.|   ....:.|.|||| :|.:..|:|.:|||.:|.|.| .|...........:|
plant   253 IMEEHTLARQKS---SGAKQHFVDALL-TLKDQYDLSEDTIIGLLWDMITAGMDTTAITAEWAMA 313

  Fly   341 YIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLR-YSSSPI-VPHVATEDTV 403
            .:.||..:.:::|||.|.::..: |.:...|.:.:||....:.|..| :..:|: :||.:..|..
plant   314 EMIKNPRVQQKVQEEFDRVVGLD-RILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVK 377

  Fly   404 ISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQL 468
            |.||.:.||:.|.:|.:.:......|.||.||.|.||||                     |.:.:
plant   378 IGGYDIPKGSNVHVNVWAVARDPAVWKNPFEFRPERFLE---------------------EDVDM 421

  Fly   469 KRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVM 503
            |.:....|||..|:|.|.|..|    |..:|.::|
plant   422 KGHDFRLLPFGAGRRVCPGAQL----GINLVTSMM 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 118/485 (24%)
CYP98A3NP_850337.1 CYP98 58..490 CDD:410749 105/453 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H107154
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.