DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2d40

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_076112.2 Gene:Cyp2d40 / 71754 MGIID:1919004 Length:338 Species:Mus musculus


Alignment Length:310 Identity:86/310 - (27%)
Similarity:136/310 - (43%) Gaps:57/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LDFLPWLYPFYQ------------RHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDA 301
            ||.:|  |.||:            ...:||.....|....:.:.:..|:. :.|.|:|.||.|||
Mouse    54 LDNMP--YSFYKVVKMFPIVLRIPGLADKIFPGQKTFLTMVDKLVTEHKR-TWDPDQPPRDLTDA 115

  Fly   302 LL------KSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII 360
            .:      |...|......|..:.:|:.|.||.......:...|..:..:.|:.||:|||||.:|
Mouse   116 FMAEMETAKGNPESSFNEANLRLVVLDLFGGGIVTTSATLTWALLLMILHPDVQRRVQEEIDEVI 180

  Fly   361 EEENRSINLLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLN 423
            .:..|. .:.|...||||.|.|.||.|::. :|: :||..:.|..:.|:.:.|||.:..|...:.
Mouse   181 GQARRP-EMADQARMPYTNAVIHEVQRFADIAPMTLPHRTSCDIEVQGFLIPKGTTLICNLSSVL 244

  Fly   424 TSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQ 488
            ..|..|..|..|.|..||:         ::|.....|:             |:|||.|:|.|:|:
Mouse   245 KDETVWEKPLRFYPEHFLD---------AQGHFVKPEA-------------FMPFSAGRRACLGE 287

  Fly   489 NLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPAD--CFPLVLTP 536
            .|||...||....::||::.|         .|:...||:|  .:.:|::|
Mouse   288 PLVRMELFLFFTCLLQRFSFS---------VPDGQPLPSDYGIYSMVVSP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 86/310 (28%)
Cyp2d40NP_076112.2 p450 <54..334 CDD:278495 86/310 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.