DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and cyp2aa1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001020728.2 Gene:cyp2aa1 / 572000 ZFINID:ZDB-GENE-070424-33 Length:498 Species:Danio rerio


Alignment Length:540 Identity:136/540 - (25%)
Similarity:237/540 - (43%) Gaps:107/540 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIG 65
            ||..|:...||   ||..|.::.:|:.|...:.:          .|:...::  .|||.|.|.:|
Zfish     1 MLVGLVKLDLA---SVGLTLFLGLIFLVLFEIFR----------IHSYKGRF--PPGPTPLPFVG 50

  Fly    66 NL-HLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIR 129
            || |.|    .||.. |.....|||::.::.||....:::|.::|.:|...|:  |.||||    
Zfish    51 NLPHFL----KSPME-FIRFMPQYGEMTTIFFGRKPVIMLNTIQLAKEAYVQD--VFSGRP---- 104

  Fly   130 YHKLFGGERSNSLALCDW-------------SQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEE 181
                       ::.|.||             :..:|:||           |:...::...:|.:.
Zfish   105 -----------AIPLFDWITNGLGIVMVTFNNSWRQQRR-----------FALHTLRNFGLGKKT 147

  Fly   182 ME----HWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSL----RFDYDDVDFQQIVQYFDE 238
            :|    ..:|.|..:::..|..::.|  ..|..|..|..:||:    ||:||:..|:.:::..:|
Zfish   148 VEDRVLEESRYLIAEMLKEEGKSMNP--QHALQNAISNIICSIVFGDRFEYDNKRFEYLLKTLNE 210

  Fly   239 IFWEINQ--GHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDA 301
            .......  |...:.:|::..|...| .||...:..:.|||.:....||: ::|.|.| |||.||
Zfish   211 NIMLAGSAAGQIFNLVPFIKHFPGPH-QKIKQNADELLGFIRDEAKEHRQ-TLDPDSP-RDFIDA 272

  Fly   302 LLKSLLEDKDV------SRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII 360
            .|..:.:.|..      ..|.::...:.|:.|.......:...|..:.:|.|:..|..|||..::
Zfish   273 YLLEIEKQKSSKDSTFHEENLVVSASDLFLAGTDTTETTIRWGLINLIQNPDVQERCHEEIVRVL 337

  Fly   361 EEENRSINLLDMNAMPYTMATIFEVLRYSS-SPIVPHVATEDTVISGYGVTKGTIVFINNYVLNT 424
            ..: |..::.|.:.:|||:||::|:.|.:: :|.|.|.....|.:.||.:.:|||:..|...:.:
Zfish   338 GYD-RLPSMDDRDKLPYTLATVYEIQRCANIAPNVMHQTILPTKLHGYNIPQGTIILTNLAAIFS 401

  Fly   425 SEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQN 489
            :::.|.:|..|||..||:.:...|...|                      |:|||:|.|.|:|:.
Zfish   402 NKEHWKHPDAFNPENFLDENGHFSKPES----------------------FIPFSLGPRVCLGET 444

  Fly   490 LVRGFGFLVVVNVMQRYNIS 509
            |.|...||.:..::||...|
Zfish   445 LARTELFLFITALLQRIRFS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 125/485 (26%)
cyp2aa1NP_001020728.2 p450 40..487 CDD:278495 125/486 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.