DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp18a1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster


Alignment Length:588 Identity:145/588 - (24%)
Similarity:253/588 - (43%) Gaps:125/588 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLATSYICIIYGVKRRVLQPVKTKNSTEINH-------------------NAYQKYTQAPGPRPW 61
            :||.||:.      :.||:.::.:...:..|                   ..|::..:.| |.||
  Fly     1 MLADSYLI------KFVLRQLQVQQDGDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLP-PGPW 58

  Fly    62 --PIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGR 124
              |:||.|..:...:.:   .|..||:|||.::|...|....:|:::.::|||...:  :..:||
  Fly    59 GLPVIGYLLFMGSEKHT---RFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRR--EEFTGR 118

  Fly   125 PDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYM--KMSQIGCEEMEHWNR 187
            ||......|.|....||.... |   :.:||.|   |...|:|...||  ...|:....|...:.
  Fly   119 PDTPFMQTLNGYGIINSTGKL-W---KDQRRFL---HDKLRQFGMTYMGNGKQQMQKRIMTEVHE 176

  Fly   188 ELGN-QLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDE---IFWEINQGHP 248
            .:|: ....|:|:::.|:|..|.:|:....|.|.||..||..|::.....:|   :|.||   |.
  Fly   177 FIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEI---HT 238

  Fly   249 LDFLPWL--YPFYQRHLNKIINWSSTIRGFIMERIIRH---------RELSVD-----LDEPDRD 297
            :|::|.:  :|......|||....:.::.|..:.|..|         |:| ||     :::...:
  Fly   239 VDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDL-VDFYLCEIEKAKAE 302

  Fly   298 FTDALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEE 362
            .|||   .|.:.|:.....:..:::.|..|...:...::.:..::.:|....||:|:|:|.:: .
  Fly   303 GTDA---ELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVV-G 363

  Fly   363 ENRSINLLDMNAMPYTMATIFEVLRYSSSPIVP----HVATEDTVISGYGVTKGT--IVFINNYV 421
            .:|...:.|:..:|.|.:||.|.:|.||  |||    |..|.|..::||.:..|:  |..||:  
  Fly   364 RHRLPTIEDLQYLPITESTILESMRRSS--IVPLATTHSPTRDVELNGYTIPAGSHVIPLINS-- 424

  Fly   422 LNTSEKFWVNPKEFNPLRFLE-PSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTC 485
            ::.....|..|:||.|.||:: ..|.:.|:                       :|:||.:|:|.|
  Fly   425 VHMDPNLWEKPEEFRPSRFIDTEGKVRKPE-----------------------YFIPFGVGRRMC 466

  Fly   486 IGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPA-----------DCFPLVLTPREK 539
            :|..|.|...||...:.|..::|:         .||...||:           :.|.:.| .|..
  Fly   467 LGDVLARMELFLFFASFMHCFDIA---------LPEGQPLPSLKGNVGATITPESFKVCL-KRRP 521

  Fly   540 IGP 542
            :||
  Fly   522 LGP 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 135/525 (26%)
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 133/519 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
32.840

Return to query results.
Submit another query.