DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2j10

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001128452.2 Gene:Cyp2j10 / 313373 RGDID:1563215 Length:502 Species:Rattus norvegicus


Alignment Length:511 Identity:140/511 - (27%)
Similarity:219/511 - (42%) Gaps:81/511 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||...|.:|||..||  ...|........::||::.||.||....:|:..|.||:|......:.
  Rat    45 PGPWRLPFVGNLFQLD--VKQPHVVIQKFVKKYGNLTSLDFGTIPSVVITGLPLIKEAFTNTEQN 107

  Fly   121 MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHW 185
            ...||......::|   .:|.|.:.:....:::||           |:...:|...:|...:|..
  Rat   108 FLNRPVTPLRKRVF---NNNGLIMSNGQTWKEQRR-----------FTMTTLKNFGLGKRSLEQR 158

  Fly   186 NRELGNQLV------PGEPINIKPLILKACANMFSQYMCSL----RFDYDDVDFQQIVQYFDE-- 238
            .:|..|.||      .|:|.:....|..|.:|:    :||:    ||:|:|..||::::..||  
  Rat   159 IQEEANYLVEAIGADKGQPFDPHFKINSAVSNI----ICSITFGERFEYEDSLFQELLRLLDEAS 219

  Fly   239 -----IFWEINQGHP--LDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDR 296
                 :..::....|  :.:||      ..|...:.||.. ::.||...:..|:: ..:.||| |
  Rat   220 CLESSMMCQLYNVFPTIIKYLP------GSHQTVLRNWEK-LKLFISCMMDSHQK-DWNPDEP-R 275

  Fly   297 DFTDALLKSLLEDKDVS------RNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEE 355
            ||.||.|..:.:.:|.:      .|.|...|:.|..|.....|::...|.||..|.::..::..|
  Rat   276 DFIDAFLTEMAKYRDKTTTSFNKENLIYSTLDLFFAGSETTSNILRWSLLYITTNPEVQEKVHSE 340

  Fly   356 IDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFIN 418
            ||.:| ...|..:..|.:|||||.|.|.||||..: .|: ||...|.|:.::|:.:.|||.:..|
  Rat   341 IDRVI-GHRRQPSTGDRDAMPYTNAVIHEVLRMGNIIPLNVPREMTADSTLAGFHLPKGTTILTN 404

  Fly   419 NYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKR 483
            ...|:...|.|..|..|||..|||..:      .|..||                 |||||:|||
  Rat   405 LTGLHRDPKEWATPDTFNPEHFLENGQ------FKKRDS-----------------FLPFSMGKR 446

  Fly   484 TCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKIS-PESLALPADCFPLVLTPRE 538
            .|.|:.|.|...|:....:||.:........|:.:. ...|.|......:...||:
  Rat   447 ACPGEQLARTELFIFFTALMQNFTFKPPVNETLSLKFRNGLTLAPVSHRICAVPRQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 140/511 (27%)
Cyp2j10NP_001128452.2 cytochrome_P450 75..496 CDD:425388 128/471 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.