DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2d1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_695225.1 Gene:Cyp2d1 / 266684 RGDID:708427 Length:504 Species:Rattus norvegicus


Alignment Length:535 Identity:136/535 - (25%)
Similarity:238/535 - (44%) Gaps:93/535 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLL 70
            |:|::.|||..|          :.||              |....:|  .|||.|||::|||..:
  Rat    14 IFTVIFILLVDL----------MHRR--------------HRWTSRY--PPGPVPWPVLGNLLQV 52

  Fly    71 DRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFG 135
            | ..:.|::.: .|..:|||::||..|....::||.|:.::|||..:|:..:.||....:..|..
  Rat    53 D-LSNMPYSLY-KLQHRYGDVFSLQKGWKPMVIVNRLKAVQEVLVTHGEDTADRPPVPIFKCLGV 115

  Fly   136 GERSNSLALCDWS-QLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHW-NRELGN-----QL 193
            ..||..:.|..:. :.:::||           ||...::...:|.:.:|.| .:|.|:     ..
  Rat   116 KPRSQGVILASYGPEWREQRR-----------FSVSTLRTFGMGKKSLEEWVTKEAGHLCDAFTA 169

  Fly   194 VPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWLYPF 258
            ..|:.||.|.::.||..|:.:..:.:.||:|:|....::|:..:|...|::     .|:|.:...
  Rat   170 QAGQSINPKAMLNKALCNVIASLIFARRFEYEDPYLIRMVKLVEESLTEVS-----GFIPEVLNT 229

  Fly   259 YQRHL------NKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALL------KSLLEDKD 311
            :...|      :|:.....|... :::.::.....:.|..:|.|:.|||.|      |...|...
  Rat   230 FPALLRIPGLADKVFQGQKTFMA-LLDNLLAENRTTWDPAQPPRNLTDAFLAEVEKAKGNPESSF 293

  Fly   312 VSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMP 376
            ...|..:.:::.|..|.......:...|..:....|:.||:|:|||.:|.:. |...:.|...||
  Rat   294 NDENLRMVVVDLFTAGMVTTATTLTWALLLMILYPDVQRRVQQEIDEVIGQV-RCPEMTDQAHMP 357

  Fly   377 YTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLR 439
            ||.|.|.||.|:.. :|: :|.:.:.|..:..:.:.|||.:.||...:...|..|..|..|:|..
  Rat   358 YTNAVIHEVQRFGDIAPLNLPRITSCDIEVQDFVIPKGTTLIINLSSVLKDETVWEKPHRFHPEH 422

  Fly   440 FLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQ 504
            ||:         ::|:....|:             |:|||.|:|.|:|:.|.|...||....::|
  Rat   423 FLD---------AQGNFVKHEA-------------FMPFSAGRRACLGEPLARMELFLFFTCLLQ 465

  Fly   505 RYNIS----SHNPST 515
            |::.|    ...|||
  Rat   466 RFSFSVPVGQPRPST 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 126/485 (26%)
Cyp2d1NP_695225.1 p450 37..496 CDD:278495 126/486 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.