DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2c12

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_113760.2 Gene:Cyp2c12 / 25011 RGDID:2470 Length:490 Species:Rattus norvegicus


Alignment Length:553 Identity:146/553 - (26%)
Similarity:235/553 - (42%) Gaps:111/553 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNLHLLDR--YRDSPF 78
            ||:.|::.::|     :.:|...:...            .|||.|.||.||...:|.  .|.|  
  Rat     8 VLSLSFLLLLY-----LWRPSPGRGKL------------PPGPTPLPIFGNFLQIDMKDIRQS-- 53

  Fly    79 AGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGR---PDFIRYHKLFGGERSN 140
              .:..::.||.:::|.||....:|::..|.::|.|...|:..|||   |.|.:..|..|     
  Rat    54 --ISNFSKTYGPVFTLYFGSQPTVVLHGYEAVKEALIDYGEEFSGRGRMPVFEKATKGLG----- 111

  Fly   141 SLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLV------PGEPI 199
                     :...|.|:.|   :.|.|:...::...:|...:|...:|....||      .|.|.
  Rat   112 ---------ISFSRGNVWR---ATRHFTVNTLRSLGMGKRTIEIKVQEEAEWLVMELKKTKGSPC 164

  Fly   200 NIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIF-------WEINQGHP--LDFLPWL 255
            :.|.:|..|..|:....:...||||.|.||..:::..:|..       :::....|  ||:.|..
  Rat   165 DPKFIIGCAPCNVICSIIFQNRFDYKDKDFLSLIENVNEYIKIVSTPAFQVFNAFPILLDYCPGN 229

  Fly   256 YPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKD------VSR 314
            :..:.:|.       :.|:.:::::|..|.| |:|:..| |||.|..|....::..      ...
  Rat   230 HKTHSKHF-------AAIKSYLLKKIKEHEE-SLDVSNP-RDFIDYFLIQRCQENGNQQMNYTQE 285

  Fly   315 NTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTM 379
            :..|.:...||||.......:...|..:.|...|..::||||..:| ..:||..:||...||||.
  Rat   286 HLAILVTNLFIGGTETSSLTLRFALLLLMKYPHITDKVQEEIGQVI-GRHRSPCMLDRIHMPYTN 349

  Fly   380 ATIFEVLRYSSSPIVP----HVATEDTVISGYGVTKGTIVFIN-NYVLNTSEKFWVNPKEFNPLR 439
            |.|.||.||..  :.|    |..|.||....|.:.|||.|..: ..||:.|::| .||:.|:|..
  Rat   350 AMIHEVQRYID--LAPNGLLHEVTCDTKFRDYFIPKGTAVLTSLTSVLHDSKEF-PNPEMFDPGH 411

  Fly   440 FLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQ 504
            ||:.:     .|.|.||                 :|:|||.|||.|:|:.|.....||.:..::|
  Rat   412 FLDEN-----GNFKKSD-----------------YFMPFSAGKRKCVGEGLASMELFLFLTTILQ 454

  Fly   505 RYNISS-HNPSTIKIS---PESLALPAD---CF 530
            .:.:.| .:|..|.|:   .|..::|..   ||
  Rat   455 NFKLKSLSDPKDIDINSIRSEFSSIPPTFQLCF 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 141/513 (27%)
Cyp2c12NP_113760.2 CYP2C-like 61..485 CDD:410758 128/475 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.