DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2a2

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_036825.1 Gene:Cyp2a2 / 24895 RGDID:2464 Length:492 Species:Rattus norvegicus


Alignment Length:534 Identity:139/534 - (26%)
Similarity:243/534 - (45%) Gaps:90/534 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGN---LHLL 70
            :|.::|:.|:..::..::..|.|...|                    |||.|.|.|||   |::.
  Rat     7 LLVVILASLSVMFLVSLWQQKIRERLP--------------------PGPTPLPFIGNYLQLNMK 51

  Fly    71 DRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIRYHKLFG 135
            |.|     :..|.|:::||.::::..|..|.:|:...:.::|.|....:..|||.:...::.||.
  Rat    52 DVY-----SSITQLSERYGPVFTIHLGPRRIVVLYGYDAVKEALVDQAEEFSGRGELPTFNILFK 111

  Fly   136 GERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLVP----- 195
            |   ...:|   |.::|.:|        .|.|:...::...:|..:::....|....|:.     
  Rat   112 G---YGFSL---SNVEQAKR--------IRRFTIATLRDFGVGKRDVQECILEEAGYLIKTLQGT 162

  Fly   196 -GEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDE--IFWEINQGHPLDFLPWLYP 257
             |.||:....:.|..:|:.:..:...||||:|.:|..:::..||  ||.....|...|....:..
  Rat   163 CGAPIDPSIYLSKTVSNVINSIVFGNRFDYEDKEFLSLLEMIDEMNIFAASATGQLYDMFHSVMK 227

  Fly   258 FYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTDALLKSLLEDKDVS-----RNTI 317
            :......:||..:..:..|::|: :|....::|.:.| |:|.|:.|..:.|:|.|:     .|.:
  Rat   228 YLPGPQQQIIKVTQKLEDFMIEK-VRQNHSTLDPNSP-RNFIDSFLIRMQEEKYVNSEFHMNNLV 290

  Fly   318 IFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATI 382
            :..|.....|..:|.:.:......:.|:.|:..::.|||:.:| ..||.....|...||||.|.|
  Rat   291 MSSLGLLFAGTGSVSSTLYHGFLLLMKHPDVEAKVHEEIERVI-GRNRQPQYEDHMKMPYTQAVI 354

  Fly   383 FEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSK 445
            .|:.|:|: :|: :|....::|...|:.:.|||.||.....|.|..||:.|.|:|||..||:   
  Rat   355 NEIQRFSNLAPLGIPRRIIKNTTFRGFFLPKGTDVFPIIGSLMTEPKFFPNHKDFNPQHFLD--- 416

  Fly   446 EQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRY---- 506
                              :|.|||:|.. |||||||||.|:|.:|.:...||::..::|.:    
  Rat   417 ------------------DKGQLKKNAA-FLPFSIGKRFCLGDSLAKMELFLLLTTILQNFRFKF 462

  Fly   507 --NISSHN--PSTI 516
              |:...|  ||.|
  Rat   463 PMNLEDINEYPSPI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 133/487 (27%)
Cyp2a2NP_036825.1 p450 33..489 CDD:278495 134/508 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.