DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2r1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_796356.2 Gene:Cyp2r1 / 244209 MGIID:2449771 Length:501 Species:Mus musculus


Alignment Length:487 Identity:137/487 - (28%)
Similarity:219/487 - (44%) Gaps:82/487 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||...|.:||:..|....|.|.......::.||:|:||..|....:|:|..::::|.|....::
Mouse    41 PGPPRLPFVGNICSLALSADLPHVYMRKQSRVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEI 105

  Fly   121 MSGRPD---FIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEM 182
            .:.||.   |::..|:  |...||.....|..    .|.||..       |..|....|...|..
Mouse   106 FADRPCLPLFMKMTKM--GGLLNSRYGRGWID----HRRLAVN-------SFHYFGSGQKSFESK 157

  Fly   183 ---EHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEIN 244
               |.|:.....:...|.|.::|.||..|.:|:.:..:...||.|:|.|||.:::.|.|.. |:.
Mouse   158 ILEETWSLIDAIETYKGGPFDLKQLITNAVSNITNLILFGERFTYEDTDFQHMIELFSENV-ELA 221

  Fly   245 QGHPLDFL----PW--LYPF--YQR----------HLNKIINWSSTIRGFIMERIIRHRELSVDL 291
            ...|: ||    ||  :.||  :||          .|:::|..::..|    :..:.|..:...|
Mouse   222 ASAPV-FLYNAFPWIGILPFGKHQRLFRNADVVYDFLSRLIEKAAVNR----KPHLPHHFVDAYL 281

  Fly   292 DEPDRDFTDALLKSLLEDKDVSRNTIIFML-EDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEE 355
            ||.|:...|.|       ...|:..:||.: |..|.|.....|::...:.::|...:|..::.:|
Mouse   282 DEMDQGQNDPL-------STFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKE 339

  Fly   356 IDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVP----HVATEDTVISGYGVTKGTIVF 416
            ||.|: ..||..:......||||.|.:.||||:.:  |||    |..:||.|:.||.:.|||.|.
Mouse   340 IDLIV-GHNRRPSWEYKCKMPYTEAVLHEVLRFCN--IVPLGIFHATSEDAVVRGYSIPKGTTVI 401

  Fly   417 INNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIG 481
            .|.|.::..||:|.:|..|.|.|||:             .:|..:..|.|         :|||:|
Mouse   402 TNLYSVHFDEKYWKDPDMFYPERFLD-------------SNGYFTKKEAL---------IPFSLG 444

  Fly   482 KRTCIGQNLVRGFGFLVVVNVMQRYNISSHNP 513
            :|.|:|:.|.|...||...:::|::::  |.|
Mouse   445 RRHCLGEQLARMEMFLFFTSLLQQFHL--HFP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 137/487 (28%)
Cyp2r1NP_796356.2 p450 40..497 CDD:278495 137/487 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.