DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp21a1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_476442.2 Gene:Cyp21a1 / 24298 RGDID:2461 Length:493 Species:Rattus norvegicus


Alignment Length:515 Identity:129/515 - (25%)
Similarity:210/515 - (40%) Gaps:124/515 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIR 129
            |.||.|.  .:.|...| .|||:.|.||.:..|....:|:|:.:.|.|.|.|.....:|||    
  Rat    38 GFLHFLQ--PNLPVYLF-GLAQKLGPIYRIRLGLQDVVVLNSNKTIEEALIQKWVDFAGRP---- 95

  Fly   130 YHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLV 194
              ::..|:.:..|::.|:|...:..:.|:|                               :.||
  Rat    96 --QILDGKMNFDLSMGDYSLTWKAHKKLSR-------------------------------SALV 127

  Fly   195 PGEPINIKPLI----LKACANM-------------FSQYMCS----LRF-DYDDVDF-------- 229
            .|...:::||:    .:.|..|             ||...||    |.| |..|...        
  Rat   128 LGMRDSMEPLVEQLTQEFCERMRAQAGASVAIHKEFSLLTCSIISCLTFGDKQDSTLLNATHSCV 192

  Fly   230 QQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEP 294
            :.:::.::.  |.:   ..||.:|:|..|....|.|:..:..:....:|:.:.||::..|  ...
  Rat   193 RDLLKAWNH--WSV---QILDIIPFLRFFPNPGLWKLKQFQESRDHIVMQELKRHKDSLV--AGQ 250

  Fly   295 DRDFTDALLKSLLEDKDV-------SRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRI 352
            .:|..|.:|:.:.:.:|.       .|:..:.:::.|:||.......:...:|::..:.:|.:|:
  Rat   251 WKDMIDYMLQGVEKQRDARDPGQLHERHVHMSVVDLFVGGTETTAATLSWAVAFLLHHPEIQKRL 315

  Fly   353 QEEIDAIIEEENRSINLLDMNAM--PYTMATIFEVLRYSSSPIV----PHVATEDTVISGYGVTK 411
            |||:|..:..   |..||..|.|  |..||||.||||.  .|:|    ||.||:.:.||||.:.|
  Rat   316 QEELDLKLAP---SSQLLYKNRMQLPLLMATIAEVLRL--RPVVPMALPHRATKASSISGYDIPK 375

  Fly   412 GTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFL 476
            .||:..|....|..|..|..|.:|.|.||||..|  ||:                     ||   
  Rat   376 DTIIIPNIQGANLDEMVWELPSKFWPDRFLESGK--SPR---------------------IP--- 414

  Fly   477 PFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTP 536
            .|..|.|.|:|:.|.|...|:|:..::|.:.:......|:   |....||.....|::.|
  Rat   415 TFGCGARVCLGEPLARLELFVVLARLLQTFTLLPPPDGTL---PSLQPLPYTGINLLIPP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 129/515 (25%)
Cyp21a1NP_476442.2 p450 31..474 CDD:278495 129/515 (25%)
Steroid-binding. /evidence=ECO:0000250 337..353 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.