DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2c13

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_612523.1 Gene:Cyp2c13 / 171521 RGDID:620363 Length:490 Species:Rattus norvegicus


Alignment Length:523 Identity:145/523 - (27%)
Similarity:229/523 - (43%) Gaps:106/523 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDR--YRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNG 118
            |||.|.|||||...:|.  .|.|    .|..::.||.:|:|..|....:|::..|.::|.|..:|
  Rat    31 PGPTPLPIIGNFFQVDMKDIRQS----LTNFSKTYGPVYTLYVGSQPTVVLHGYEALKEALVDHG 91

  Fly   119 KVMSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRH----CSPREFSCFYMKMSQIGC 179
            :..|||               ..|.:|   :...|.:.:|..|    .:.|.|:...::...:|.
  Rat    92 EEFSGR---------------GRLPIC---EKVAKGQGIAFSHGNVWKATRHFTVKTLRNLGMGK 138

  Fly   180 EEMEHWNRELGNQLVP------GEPINIKPLILKACA--NMFSQYMCSLRFDYDDVDFQQIVQYF 236
            ..:|...:|....||.      |.|.:  |..:..||  |:....:...||||:|.||..:::..
  Rat   139 GTIEDKVQEEAKWLVKELKKTNGSPCD--PQFIMGCAPGNVICCIILQNRFDYEDKDFLNLIEKV 201

  Fly   237 DEIFWEINQGHP-----------LDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVD 290
            :|....|:.  |           ||:.|..:..|.::    ..|   ::.:::|:|..|.| |:|
  Rat   202 NEAVKIISS--PGIQVFNIFPILLDYCPGNHNIYLKN----YTW---VKSYLLEKIKEHEE-SLD 256

  Fly   291 LDEPDRDFTDALLKSLLEDKDVSRNT--------IIFMLED-FIGGHSAVGNLVMLVLAYIAKNV 346
            :..| |||.|..   |:|....:.|.        :..|:.| |..|...|.:.:...|..:.|..
  Rat   257 VSNP-RDFIDYF---LIERNQENANQWMNYTLEHLAIMVTDLFFAGIETVSSTMRFALLLLMKYP 317

  Fly   347 DIGRRIQEEIDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVP----HVATEDTVISGY 407
            .:..::|||||.:| ..:||.::.|.:.||||.|.:.||.||..  |.|    |..|.||....|
  Rat   318 HVTAKVQEEIDHVI-GRHRSPSMQDRSHMPYTNAMVHEVQRYID--IGPNGLLHDVTCDTKFRNY 379

  Fly   408 GVTKGTIVFIN-NYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRN 471
            .:.|||.|..: ..||:.|::| .||:.|:|..||:.:     .|.|.||               
  Rat   380 FIPKGTAVLTSLTSVLHDSKEF-PNPEMFDPGHFLDEN-----GNFKKSD--------------- 423

  Fly   472 IPHFLPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISS-HNPSTIKISP--ESLALPADCFPLV 533
              :|:|||.|||.|:|::|.|...||.:..::|.:.:.| .:|..|..:|  .||:.....|.:.
  Rat   424 --YFIPFSAGKRMCLGESLARMELFLFLTTILQNFKLKSLVDPKDINTTPICSSLSSVPPTFQMR 486

  Fly   534 LTP 536
            ..|
  Rat   487 FIP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 145/523 (28%)
Cyp2c13NP_612523.1 p450 30..487 CDD:278495 144/519 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.