DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spo and Cyp2g1

DIOPT Version :9

Sequence 1:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_038837.1 Gene:Cyp2g1 / 13108 MGIID:109612 Length:494 Species:Mus musculus


Alignment Length:501 Identity:140/501 - (27%)
Similarity:214/501 - (42%) Gaps:93/501 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV 120
            |||.|.|.:||  .|....|:.|..|..|.::||.::::.||....:|:...|.::|.|......
Mouse    35 PGPTPIPFLGN--FLQVRTDATFQSFQKLQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADD 97

  Fly   121 MSGRPDFIRYHKLFGGERSNSLALCD---WSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEM 182
            .|||.:.....|.|.|   ..|||.:   |..|              |.||...::...:|...:
Mouse    98 FSGRGEMPTLEKNFQG---YGLALSNGERWKIL--------------RRFSLTVLRNFGMGKRSI 145

  Fly   183 EHWNRELGNQL------VPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFW 241
            |...:|....|      |.|.||:....:.:..:|:....:...||||.|..||.:::..:|.|.
Mouse   146 EERIQEEAGYLLEELHKVKGAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFV 210

  Fly   242 EINQGHPLDFLPW--LYPFY--------QRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDR 296
            |:::       ||  ||..|        .|| |.:.|....::.||..| ::..|.|.|...| |
Mouse   211 EMSK-------PWAQLYDMYWKVMQYFPGRH-NYLYNLIEDLKDFIASR-VKINEASFDPSNP-R 265

  Fly   297 DFTDALLKSLLEDKDVS------RNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEE 355
            ||.|..|..:.:||...      :|.::..|..|..|...|.:.:......:.|..::..:|.||
Mouse   266 DFIDCFLIKMHQDKSDPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVEAKIHEE 330

  Fly   356 IDAIIEEENRSINLLDMNAMPYTMATIFEVLRYSS-SPI-VPHVATEDTVISGYGVTKGTIVF-I 417
            |:.:| ..:|:..:.|...||||.|.|.|:.|.:. .|: |||..|.||...||.:.|||.|: :
Mouse   331 INQVI-GTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVTRDTHFRGYLLPKGTDVYPL 394

  Fly   418 NNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFLPFSIGK 482
            ...||. ..|::..|..|.|..||:                     |:.:.|:| ..|:.||.||
Mouse   395 FGSVLK-DPKYFRYPDAFYPQHFLD---------------------EQGRFKKN-DAFVVFSSGK 436

  Fly   483 RTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPAD 528
            |.|:|:.|.|...||...:::||:::            .||..|||
Mouse   437 RICVGEALARMELFLYFTSILQRFSL------------RSLVPPAD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoNP_001286943.1 p450 56..540 CDD:299894 140/501 (28%)
Cyp2g1NP_038837.1 p450 34..491 CDD:278495 140/501 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.